[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yceE
DDBJ      :yceE         putative stress adaptation protein
Swiss-Prot:YCEE_BACSU   RecName: Full=Uncharacterized protein yceE;

Homologs  Archaea  0/68 : Bacteria  96/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.18.1
:192 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   16->192 3ibzA PDBj 2e-52 54.3 %
:RPS:PDB   1->173 2a5iA PDBj 1e-41 14.4 %
:RPS:SCOP  5->111 1wmdA1  b.18.1.20 * 5e-21 18.3 %
:RPS:PFM   62->184 PF02342 * TerD 2e-42 65.9 %
:HMM:PFM   61->185 PF02342 * TerD 2e-51 57.6 125/128  
:HMM:PFM   3->44 PF10138 * Tellurium_res 0.00014 22.9 35/99  
:BLT:SWISS 1->192 YCEE_BACSU e-112 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12085.1 GT:GENE yceE GT:PRODUCT putative stress adaptation protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 313396..313974 GB:FROM 313396 GB:TO 313974 GB:DIRECTION + GB:GENE yceE GB:PRODUCT putative stress adaptation protein GB:FUNCTION 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf: putative factor GB:PROTEIN_ID CAB12085.1 GB:DB_XREF GOA:O34384 InterPro:IPR003325 SubtiList:BG12769 UniProtKB/Swiss-Prot:O34384 GB:GENE:GENE yceE LENGTH 192 SQ:AASEQ MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDNRTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCELYRHGGEWKFNAIGSGFSGGLAALCRNYGLQV GT:EXON 1|1-192:0| SW:ID YCEE_BACSU SW:DE RecName: Full=Uncharacterized protein yceE; SW:GN Name=yceE; OrderedLocusNames=BSU02910; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->192|YCEE_BACSU|e-112|100.0|192/192| BL:PDB:NREP 1 BL:PDB:REP 16->192|3ibzA|2e-52|54.3|175/176| RP:PDB:NREP 1 RP:PDB:REP 1->173|2a5iA|1e-41|14.4|160/306| RP:PFM:NREP 1 RP:PFM:REP 62->184|PF02342|2e-42|65.9|123/125|TerD| HM:PFM:NREP 2 HM:PFM:REP 61->185|PF02342|2e-51|57.6|125/128|TerD| HM:PFM:REP 3->44|PF10138|0.00014|22.9|35/99|Tellurium_res| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF02342|IPR003325| RP:SCP:NREP 1 RP:SCP:REP 5->111|1wmdA1|5e-21|18.3|104/116|b.18.1.20| OP:NHOMO 394 OP:NHOMOORG 100 OP:PATTERN -------------------------------------------------------------------- ------------------------------------7544-7753-----------------1----AED-----------------------------------3---2-------------------------------------4--33-----------21----14--------------5-------3444443333343334--3353333---3---------4----------------------------------------------3----------------------------------------------32------------5114----4----------74-----------------------------------------------------------------------1--------------------------------3-------------------------------------------1-----------------52----------------6------1----------------5-----------------------------------------------------------------------4----------------------2----------5------36----5---3---------3---------66----4---------------------------45555555555------------------------------3--------5453----------------444----------------------------------------1-------------------------------------------------------- ----61------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 100.0 SQ:SECSTR EEccccTTcEEEEEEEEEEEEEEEccTTcccccccEEEEEETTEEEEEEEEEEEEEEcTTccccccccccTccccccccccccHHHHHHHHHHHHHTTccTTcccccccHHHHHHHHHTcccccHHHHHHTHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHcTccTTcccEEEcTTTcccccccccccc PSIPRED ccEEEEcccccccccccccccEEEEEEEEEcccccccccccEEEEEEEEcccccccccccEEEcccccccccEEEEccccccccccccEEEEEEEcccccccccEEEEEEEEcccccccccHHHccccEEEEEEccccEEEEEEEccccccccEEEEEEEEEEEcccEEEEEEEccccccHHHHHHHHcccc //