[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yceJ
DDBJ      :yceJ         putative efflux transporter
Swiss-Prot:YCEJ_BACSU   RecName: Full=Uncharacterized MFS-type transporter yceJ;

Homologs  Archaea  15/68 : Bacteria  393/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:390 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   227->355 2cfqA PDBj 2e-05 31.5 %
:RPS:SCOP  30->351 1pv6A  f.38.1.2 * 2e-16 15.8 %
:HMM:SCOP  1->384 1pw4A_ f.38.1.1 * 3.3e-77 32.2 %
:RPS:PFM   40->333 PF07690 * MFS_1 1e-19 32.2 %
:HMM:PFM   8->225 PF07690 * MFS_1 2.1e-36 27.2 217/353  
:HMM:PFM   206->381 PF07690 * MFS_1 4.5e-18 25.7 175/353  
:BLT:SWISS 1->390 YCEJ_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12090.1 GT:GENE yceJ GT:PRODUCT putative efflux transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(319180..320352) GB:FROM 319180 GB:TO 320352 GB:DIRECTION - GB:GENE yceJ GB:PRODUCT putative efflux transporter GB:FUNCTION 16.1: Circulate 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB12090.1 GB:DB_XREF GOA:O34724 InterPro:IPR001958 SubtiList:BG12774 UniProtKB/Swiss-Prot:O34724 GB:GENE:GENE yceJ LENGTH 390 SQ:AASEQ MNRIWLFFSVMFVIGTDTFLLSPLLPLLQDQFHVSTDLSGWMVSAYALGYALFAFIAGPISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSAAFVTPQIWASIPVIVQPSQIIKGMGIATAGLAASQMLGLPIGGFLASFTWHTPFFVLSACSLILLLILAAVMPGIRPSEPLARPSIVNPYRELFSLPKTSVILLAYFLFQTGNFASFSFLGTWLSADYHLTVSQIGAAMLVLGLGNMLGSLIGSRVSEKLGMFKTLISGMLLMGALYFALPFFPNLFLVEAGFFLTFFTAGIIFPLMMGVFQSIAPNARGTIASLSNAAMYAGTTVGTSIAGFLYQSTQHFGAVTGFTAILFILSMTLYQTISKTGKRQSTARAQL GT:EXON 1|1-390:0| SW:ID YCEJ_BACSU SW:DE RecName: Full=Uncharacterized MFS-type transporter yceJ; SW:GN Name=yceJ; OrderedLocusNames=BSU02960; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->390|YCEJ_BACSU|0.0|100.0|390/390| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 11 TM:REGION 5->27| TM:REGION 41->63| TM:REGION 76->98| TM:REGION 128->150| TM:REGION 158->180| TM:REGION 196->217| TM:REGION 236->258| TM:REGION 264->286| TM:REGION 295->317| TM:REGION 327->349| TM:REGION 354->376| SEG 20->28|llspllpll| SEG 161->174|lsacslilllilaa| BL:PDB:NREP 1 BL:PDB:REP 227->355|2cfqA|2e-05|31.5|124/417| RP:PFM:NREP 1 RP:PFM:REP 40->333|PF07690|1e-19|32.2|292/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 8->225|PF07690|2.1e-36|27.2|217/353|MFS_1| HM:PFM:REP 206->381|PF07690|4.5e-18|25.7|175/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 30->351|1pv6A|2e-16|15.8|322/417|f.38.1.2| HM:SCP:REP 1->384|1pw4A_|3.3e-77|32.2|382/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 906 OP:NHOMOORG 427 OP:PATTERN ------1-1111111-------------------11-------21--1--1------------1---- 121-8-233332112--11-11--211111111---3623-1321111-21-1131-2--1231-22131---------------1--11-----------431-51111-----------------1-1-111--1--11---11------------------------1------------1-1-----2-C66666567249556A4355596431235233233231E9-1112111111111142234212-44-21112211552-----343-----------------------------------------------32------------22-111-----1----231-11--1---------1-6111-----2-231---11221----------1---1--11124--6441421432121-1-1-2-22221--4444444411122----------------------------------2213-1----5525-1-1-12261121214214-522-1211--41112215243--22111-------------211-1--1--2---1---1---------2---------------2---------11-2222-2-----1-12112-1-41111-1111--------------1221-11------------------------------35324-212-212122222121125---------322222222222---1-1--1-------15111------------44334-3--1--11-1-122-11---22211---12-1-1112------11------------1------111111-------------------------------------------1----1- ---------------1-------3121------121------------1-2111--1----1-----------------------------------------111----------------------------------------------------3---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 31.8 SQ:SECSTR ##################################################################################################################################################################################################################################HHHTTTcccTTTcHHHHHHHHHHHHHHHHHHHHHHTTcTTccHHHHHTTccHHHHHHHTHHHTccHHGGGccTTHHHTTH##HHHHHHHHHH###HHHHTccHHHHcccTHHHHHHHHHHHHHHHccHH################################### DISOP:02AL 182-190, 380-390| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //