[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yclP
DDBJ      :yclP         putative iron-siderophore ABC transporter (ATP-binding protein)
Swiss-Prot:YCLP_BACSU   RecName: Full=Uncharacterized ABC transporter ATP-binding protein yclP;

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  198/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:252 amino acids
:PSIPRED
:BLT:PDB   1->217 1l2tB PDBj 2e-31 37.6 %
:RPS:PDB   2->241 3b5jA PDBj 2e-42 23.8 %
:RPS:SCOP  1->225 1b0uA  c.37.1.12 * 7e-39 31.2 %
:HMM:SCOP  4->222 1ii8.1 c.37.1.12 * 3.8e-64 33.3 %
:RPS:PFM   41->162 PF00005 * ABC_tran 3e-08 33.3 %
:HMM:PFM   41->164 PF00005 * ABC_tran 4.1e-18 27.0 115/118  
:HMM:PFM   140->242 PF04937 * DUF659 3.2e-06 21.6 102/153  
:HMM:PFM   17->58 PF03193 * DUF258 1.3e-05 29.3 41/161  
:BLT:SWISS 1->252 YCLP_BACSU e-141 100.0 %
:PROS 136->150|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12190.1 GT:GENE yclP GT:PRODUCT putative iron-siderophore ABC transporter (ATP-binding protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 434256..435014 GB:FROM 434256 GB:TO 435014 GB:DIRECTION + GB:GENE yclP GB:PRODUCT putative iron-siderophore ABC transporter (ATP-binding protein) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 12354229; Product type pt : putative transporter GB:PROTEIN_ID CAB12190.1 GB:DB_XREF GOA:P94420 InterPro:IPR003593 SubtiList:BG12036 UniProtKB/Swiss-Prot:P94420 GB:GENE:GENE yclP LENGTH 252 SQ:AASEQ MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLSIMSRLIKKDSGEIYIDGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYSQGRLTEEDWVHINQALSYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPLNNLDMKHSVEIMKLLKRLVEELGKTIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEEMIETSVLEEIYDMTIPIQTIDNQRIGVYFS GT:EXON 1|1-252:0| SW:ID YCLP_BACSU SW:DE RecName: Full=Uncharacterized ABC transporter ATP-binding protein yclP; SW:GN Name=yclP; OrderedLocusNames=BSU03820; SW:KW ATP-binding; Complete proteome; Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->252|YCLP_BACSU|e-141|100.0|252/252| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 136->150|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 1->217|1l2tB|2e-31|37.6|213/232| RP:PDB:NREP 1 RP:PDB:REP 2->241|3b5jA|2e-42|23.8|235/243| RP:PFM:NREP 1 RP:PFM:REP 41->162|PF00005|3e-08|33.3|117/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 41->164|PF00005|4.1e-18|27.0|115/118|ABC_tran| HM:PFM:REP 140->242|PF04937|3.2e-06|21.6|102/153|DUF659| HM:PFM:REP 17->58|PF03193|1.3e-05|29.3|41/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 1->225|1b0uA|7e-39|31.2|224/258|c.37.1.12| HM:SCP:REP 4->222|1ii8.1|3.8e-64|33.3|216/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 51758 OP:NHOMOORG 1176 OP:PATTERN VVODWLKLaaaWZWaTkLSSSTPZvORmnZiUKBFEFGJHJGEXcSYpOV**mASgSUaOTOMIc2AB TbtM*eedoopYhVXRSLL-LjBBc*MMMMLStrqst***SzU*r*vdophV***PQiCDs**j*n****fcedd*gegS*hjC9EBCXYYP6RGKK-1HJYOOMhQdOW8999999AABABBBKVTKRaNOSTdPlrq**MLM*ZqlmveemeiUVLKPJMLedbj***YKQIJKIJQHKGKkWeRNxmAcg*************************gt***pu********esstqtqnrssssrqakggh*jhe**fTfXl**UV**gZWZorkmovuz*zu****y*yxvtz*w*ygggffgiilihff*wvkjkyx*st***********q*ry***fqpm*ym***owVN**vkYdkqTZnivsReiaOdRQQKKPNNOdV***aTw****************-kl*hd*l***TF**************IKL**********POPPPPPPmSYIOha*776666666478999B89B99A99984A6KEBBCF***********u***y********l********BN**r*irqp******cjmJZMRiVKKJILKJPNOXrke**UgVvnYlvbamHgZdVVXjVaVWSVowa*PMMTFLKLNJICCDDEDDDEKUHHMMLoqySqXfMUNxSYbaYSaeZUWWUXbZYdZ6-FKRNP321433*x**Y***********z-**z**y*******zzzyyx*****ilgrqoppqrpqponrnpp*upqwwvxV4************44KJBEBBDPPQPOF*o*ccbbcYIRVQOXSVlPRTQRJVJTXoZutosz***z****n***HGGEFIHFGMlrr*vvvwv*****NONLNMMMPOA99998GWUTMNLLAB9BAABA*CdECBCE-CGCEKHCSSQDGPCJGAACenycZs*trsFeN 4444qmI1dKADTdVLNNGLQXPXQdQKKDIEJPPNBJFGFGHGFFMIMTTOaULLNDFIHHIA989A39C9CFD8B19D8CCDBI58-IPCNIFEDBCBAAFTOM7RftmalTrfgJJGDJXLtrC*D**p4oVsLGLBjBMjVARIHCeBC*HXURvLg*LsTeB*al*cgeNGKEF*HLEFN*mr*L**NM*z**S ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ PSIPRED cEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHccEEcccccccccccHHHHHHccccHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHcccccHHHHcEEEEEEEEccEEEEEccc //