[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yczE
DDBJ      :yczE         integral inner membrane protein regulating antibiotic production
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->90 PF02588 * DUF161 4.1e-07 19.8 81/82  
:HMM:PFM   107->185 PF02588 * DUF161 2.3e-10 20.5 78/82  
:BLT:SWISS 35->170 YYAS_BACSU 3e-07 23.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12152.2 GT:GENE yczE GT:PRODUCT integral inner membrane protein regulating antibiotic production GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(408240..408887) GB:FROM 408240 GB:TO 408887 GB:DIRECTION - GB:GENE yczE GB:PRODUCT integral inner membrane protein regulating antibiotic production GB:FUNCTION 15.11: Biosynthesis of natural products GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 15849754, 16850406, 17827323; Product type m : membrane component GB:PROTEIN_ID CAB12152.2 GB:DB_XREF InterPro:IPR003740 SubtiList:BG12779 UniProtKB/TrEMBL:O34927 GB:GENE:GENE yczE LENGTH 215 SQ:AASEQ MKQELVLRWTFYFAGLIILAFGVSLTIEGKALGISPWDAFHYSLFQHFGLTVGQWSIIIGALIVGFTSLFTRAWPKIGALLNMVLIGVFIDFFNFILPALSTYTGSIIVFSLGVVLIGYGVGVYVSAGLGAGPRDSLMMLITEKTGWNVQWVRNGMELTILFAAWGMGGPIGFGTILTAILTGLILRFSLPQSIQLLNYAVARRTAAVKASPPVH GT:EXON 1|1-215:0| BL:SWS:NREP 1 BL:SWS:REP 35->170|YYAS_BACSU|3e-07|23.5|136/201| TM:NTM 4 TM:REGION 5->27| TM:REGION 47->69| TM:REGION 77->99| TM:REGION 108->129| SEG 112->125|lgvvligygvgvyv| SEG 171->186|igfgtiltailtglil| HM:PFM:NREP 2 HM:PFM:REP 9->90|PF02588|4.1e-07|19.8|81/82|DUF161| HM:PFM:REP 107->185|PF02588|2.3e-10|20.5|78/82|DUF161| OP:NHOMO 85 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- ----1---------1----------------------1-------1---11-111-------1-1-1-1---------------------------------------------------------------------------11-------------------------------------1---------322222-22-221122-222111211-131-1------2----------------------1---------------------------------------------------------------------11---------1---211---------1----11----------------------------------------------------------------------------------------------------------1-----------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-------------------------------111------------------------------------------------------------------------1--------------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 215-216| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //