[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ydaM
DDBJ      :ydaM         putative glycosyltransferase associated to biofilm formation
Swiss-Prot:YDAM_BACSU   RecName: Full=Uncharacterized glycosyltransferase ydaM;         EC=2.4.-.-;

Homologs  Archaea  38/68 : Bacteria  525/915 : Eukaryota  35/199 : Viruses  1/175   --->[See Alignment]
c.68.1
:420 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->263 2z86A PDBj 8e-10 26.3 %
:RPS:PDB   46->299 3e25A PDBj 3e-28 16.0 %
:RPS:SCOP  29->300 1xhbA2  c.68.1.17 * 1e-24 17.3 %
:HMM:SCOP  29->334 1xhbA2 c.68.1.17 * 5.6e-61 28.7 %
:RPS:PFM   52->184 PF00535 * Glycos_transf_2 1e-13 36.2 %
:HMM:PFM   52->226 PF00535 * Glycos_transf_2 7.8e-31 29.0 169/169  
:BLT:SWISS 1->420 YDAM_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12237.1 GT:GENE ydaM GT:PRODUCT putative glycosyltransferase associated to biofilm formation GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 482577..483839 GB:FROM 482577 GB:TO 483839 GB:DIRECTION + GB:GENE ydaM GB:PRODUCT putative glycosyltransferase associated to biofilm formation GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12237.1 GB:DB_XREF GOA:P96587 InterPro:IPR001173 SubtiList:BG12060 UniProtKB/Swiss-Prot:P96587 GB:GENE:GENE ydaM LENGTH 420 SQ:AASEQ MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNEEVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRIIFDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLSIEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG GT:EXON 1|1-420:0| SW:ID YDAM_BACSU SW:DE RecName: Full=Uncharacterized glycosyltransferase ydaM; EC=2.4.-.-; SW:GN Name=ydaM; OrderedLocusNames=BSU04300; SW:KW Complete proteome; Glycosyltransferase; Membrane; Transferase;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->420|YDAM_BACSU|0.0|100.0|420/420| GO:SWS:NREP 4 GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 4->26| TM:REGION 302->324| TM:REGION 337->359| TM:REGION 373->395| SEG 301->315|fdlfyffftyflfff| BL:PDB:NREP 1 BL:PDB:REP 41->263|2z86A|8e-10|26.3|217/580| RP:PDB:NREP 1 RP:PDB:REP 46->299|3e25A|3e-28|16.0|238/270| RP:PFM:NREP 1 RP:PFM:REP 52->184|PF00535|1e-13|36.2|127/148|Glycos_transf_2| HM:PFM:NREP 1 HM:PFM:REP 52->226|PF00535|7.8e-31|29.0|169/169|Glycos_transf_2| RP:SCP:NREP 1 RP:SCP:REP 29->300|1xhbA2|1e-24|17.3|271/316|c.68.1.17| HM:SCP:REP 29->334|1xhbA2|5.6e-61|28.7|303/0|c.68.1.17|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 1133 OP:NHOMOORG 599 OP:PATTERN --1-1-234333233322--1--1---1--1-2-21---------1-2-1133-34234141--2-22 35121--1111----------1----------1333-2-11-1-11--1--22411-----11--1-23221111111--1--1--2-3222-5-----31315253121--------------1--1-2-2313-2---1---1342552243233212332112343412121122111111---112-2111-3-22123242244122231322-11211-11111152111111111111111--111142-----1-13322221121-13231---222-11------------------------1----1---121162333333324222331211143--12-1-111212--12---13--3122--------321--1--2-11211111111111-54454321123-244154332432321-31111211121--------211--3------------11--11--1------1-11--11-12111-2222231222122-33333-212-1312-21111---1-1--1--11----2--------11------4-1-21-2--111123-1232-553532132--------1----------2--2----2211-1--1--1-1-----11--1-----------1------1111-212223233332-232221123222-33233333333-33111-1111111111--1121--11-1211111-11111---2---------1-1--111111---------32333-2---11----112211-1-21-------1----3232------21--1121211111------2-112211---1--1--------------1------2-------21142-1---211 ---------------21-1----1-1--------------------33---11-11-1-111------------------------------1---------2-----1-------------------------------------------------1--------------2--1-1811113A66B2E3------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 280 STR:RPRED 66.7 SQ:SECSTR ###################HHHHTccTTcEEccccccHHHHHHHETTTccEEEEEEEcccTTTHHHHHHTTGGGcTTTcEcEEEEEEccccccHHHHHHHTTcEEEEHHHHcTTcccccccHHHHHHHHHHHccccEEEEcccccccccTTHHHHHcHHHHHcccccEEEEEEcccHHHHHTEEcccHHHHTHHHHHHHHcGGGTTcccTTcccEEEEHHHHHHcccccGccGGHHHHHHHHHHHHHcTTcEEEEEccccccccHHHHHHHHHHHHHHHHTTccccccccEEccccEEc######################################################################################################################### DISOP:02AL 40-44, 410-420| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHccccEEEEEccEEEEcccccEEEEcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccEEEEccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccccc //