[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ydcF
DDBJ      :ydcF         hypothetical protein
Swiss-Prot:YDCF_BACSU   RecName: Full=Uncharacterized protein ydcF;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->97 YDCF_BACSU 3e-56 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12282.1 GT:GENE ydcF GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 524492..524785 GB:FROM 524492 GB:TO 524785 GB:DIRECTION + GB:GENE ydcF GB:PRODUCT hypothetical protein GB:FUNCTION 18: Unknown function GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12282.1 GB:DB_XREF SubtiList:BG12093 UniProtKB/Swiss-Prot:P96623 GB:GENE:GENE ydcF LENGTH 97 SQ:AASEQ MERKEHCFCKEKQFSYGLSMWRNIGRFLSWSTCPHSNVIMEFFHVLQKQKEDLCITYGIVLEGAEAKKWGEIIGTELSKDMPTAVSRLVHLYGGVIK GT:EXON 1|1-97:0| SW:ID YDCF_BACSU SW:DE RecName: Full=Uncharacterized protein ydcF; SW:GN Name=ydcF; OrderedLocusNames=BSU04750; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->97|YDCF_BACSU|3e-56|100.0|97/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccEEHHHHHEEcccHHHHHHHHHHHHccccHHHHHHHHHHHccccc //