[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ydeO
DDBJ      :ydeO         putative integral inner membrane protein
Swiss-Prot:YDEO_BACSU   RecName: Full=UPF0750 membrane protein ydeO;

Homologs  Archaea  1/68 : Bacteria  228/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:290 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   209->284 2cz4B PDBj 2e-09 18.9 %
:RPS:PFM   114->152 PF02588 * DUF161 3e-04 48.7 %
:RPS:PFM   227->281 PF10035 * DUF2179 3e-09 49.1 %
:HMM:PFM   18->95 PF02588 * DUF161 1.4e-13 22.7 75/82  
:HMM:PFM   114->194 PF02588 * DUF161 7.6e-15 28.4 81/82  
:HMM:PFM   227->281 PF10035 * DUF2179 1.2e-21 47.3 55/55  
:HMM:PFM   182->245 PF07268 * EppA_BapA 0.00011 25.0 64/163  
:BLT:SWISS 1->290 YDEO_BACSU e-144 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12335.1 GT:GENE ydeO GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 574690..575562 GB:FROM 574690 GB:TO 575562 GB:DIRECTION + GB:GENE ydeO GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB12335.1 GB:DB_XREF InterPro:IPR019264 SubtiList:BG12142 UniProtKB/TrEMBL:P96672 GB:GENE:GENE ydeO LENGTH 290 SQ:AASEQ MNTPKKHKKFKAKMILQIIMVIIGGIIAAYGLETVLIPNSVSDGGVTGLSIVGSQLFNLPLGILIAVINIPFVWLGYKQIGKSFALLSIIGIVSLAAGTSFFHHTPAIIEGDTLLITVVGGIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFLNLFVFIFVSTVFGLQGALLSVIAYYIASKVIHVVEEGLSGSKTFQIITTQPELMVETIRDQLGRSATYKEAYGGFSHEKFKEITCVINRLEETKLKEIINDIDKTAFVTVYDVAEVKGSNFRNLNHH GT:EXON 1|1-290:0| SW:ID YDEO_BACSU SW:DE RecName: Full=UPF0750 membrane protein ydeO; SW:GN Name=ydeO; OrderedLocusNames=BSU05280; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->290|YDEO_BACSU|e-144|100.0|290/290| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 15->37| TM:REGION 51->73| TM:REGION 82->104| TM:REGION 109->131| SEG 14->27|milqiimviiggii| SEG 159->171|lilflnlfvfifv| RP:PDB:NREP 1 RP:PDB:REP 209->284|2cz4B|2e-09|18.9|74/92| RP:PFM:NREP 2 RP:PFM:REP 114->152|PF02588|3e-04|48.7|39/82|DUF161| RP:PFM:REP 227->281|PF10035|3e-09|49.1|55/55|DUF2179| HM:PFM:NREP 4 HM:PFM:REP 18->95|PF02588|1.4e-13|22.7|75/82|DUF161| HM:PFM:REP 114->194|PF02588|7.6e-15|28.4|81/82|DUF161| HM:PFM:REP 227->281|PF10035|1.2e-21|47.3|55/55|DUF2179| HM:PFM:REP 182->245|PF07268|0.00011|25.0|64/163|EppA_BapA| OP:NHOMO 658 OP:NHOMOORG 229 OP:PATTERN ------------------------------------------1------------------------- ------------------------------------------------------------------------------1---------11-2-3--------1-111--1111111111111111-----------211-----1-------------------------------------------11-247999998997999999546646999333647755555545511111111111111232134322222-22211--335324323333234344222222222222224444444444444222212222411243333333343414333333421231112-3322311111223111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21112-1-11--1-------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------111-111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 25.5 SQ:SECSTR ################################################################################################################################################################################################################EEGGGHHHHHHHHHHTTccccEEEEEcccccccccEEEEEEEEcHH##HHHHHHHHHHHHTTEEEEEEEEETGGGG###### DISOP:02AL 1-7, 285-290| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEEEcEEccccccccccc //