[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ydjO
DDBJ      :ydjO         conserved hypothetical protein
Swiss-Prot:YDJO_BACSU   RecName: Full=Uncharacterized protein ydjO;

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->51 PF04606 * Ogr_Delta 0.00072 55.6 9/47  
:BLT:SWISS 1->69 YDJO_BACSU 1e-39 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12446.1 GT:GENE ydjO GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(681255..681464) GB:FROM 681255 GB:TO 681464 GB:DIRECTION - GB:GENE ydjO GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12446.1 GB:DB_XREF SubtiList:BG12805 UniProtKB/Swiss-Prot:O34759 GB:GENE:GENE ydjO LENGTH 69 SQ:AASEQ MSYYNKRNQEPLPKEDVSTWECTKEDCNGWTRKNFASSDTPLCPLCGSKMVDGIRSLVNLQNNSQTKTS GT:EXON 1|1-69:0| SW:ID YDJO_BACSU SW:DE RecName: Full=Uncharacterized protein ydjO; SW:GN Name=ydjO; OrderedLocusNames=BSU06270; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->69|YDJO_BACSU|1e-39|100.0|69/100| HM:PFM:NREP 1 HM:PFM:REP 43->51|PF04606|0.00072|55.6|9/47|Ogr_Delta| OP:NHOMO 26 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111121--11-11-2-------------12---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 59-69| PSIPRED ccccccccccccccccccEEEEcccccccccccccccccccccccccccccccEEEcEEcccccccccc //