[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yesV
DDBJ      :yesV         putative integral inner membrane component
Swiss-Prot:YESV_BACSU   RecName: Full=Uncharacterized protein yesV;

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:208 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->95 PF04854 * DUF624 5e-29 46.8 77/77  
:HMM:PFM   75->132 PF06687 * SUR7 2.6e-05 35.7 56/214  
:BLT:SWISS 1->208 YESV_BACSU 9e-98 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12523.1 GT:GENE yesV GT:PRODUCT putative integral inner membrane component GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 769487..770113 GB:FROM 769487 GB:TO 770113 GB:DIRECTION + GB:GENE yesV GB:PRODUCT putative integral inner membrane component GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406, 17449691; Product type pm: putative membrane component GB:PROTEIN_ID CAB12523.1 GB:DB_XREF InterPro:IPR006938 SubtiList:BG12856 UniProtKB/Swiss-Prot:O31525 GB:GENE:GENE yesV LENGTH 208 SQ:AASEQ MKTTVTDALYAGCEAVVKIAWLNGLWLLFTLLGGVLFGWAPSTAAMCAVIRKWLMGQKDVPIFSLFLDTYKKEFLKVNAIGLAFSALLLILSANYHYFSASTNWLSFAVTSCTLLAGLLYIIALMYVFPLYVHYQLPLRKYIPQALLFGAMRPLTTGCMLIGCGFVLYLLYTLPGLIPFYGPCLFGLVLMFFALRGFQKTEAQHHQAG GT:EXON 1|1-208:0| SW:ID YESV_BACSU SW:DE RecName: Full=Uncharacterized protein yesV; SW:GN Name=yesV; OrderedLocusNames=BSU07040; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->208|YESV_BACSU|9e-98|100.0|208/208| TM:NTM 5 TM:REGION 13->35| TM:REGION 73->93| TM:REGION 110->132| TM:REGION 144->166| TM:REGION 175->197| SEG 21->39|wlnglwllftllggvlfgw| SEG 79->93|aiglafsalllilsa| HM:PFM:NREP 2 HM:PFM:REP 19->95|PF04854|5e-29|46.8|77/77|DUF624| HM:PFM:REP 75->132|PF06687|2.6e-05|35.7|56/214|SUR7| OP:NHOMO 19 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------252212-----112-----------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 198-208| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //