[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yfhD
DDBJ      :yfhD         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->39 YFHD_BACSU 2e-19 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12678.1 GT:GENE yfhD GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(924210..924401) GB:FROM 924210 GB:TO 924401 GB:DIRECTION - GB:GENE yfhD GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12678.1 GB:DB_XREF SubtiList:BG12879 UniProtKB/Swiss-Prot:O31572 GB:GENE:GENE yfhD LENGTH 63 SQ:AASEQ MGRNHIHKNRDKNKQKLPQVPDALKRETDGVYEEYSTELADADDREAQERAKAADNRAKKKSR GT:EXON 1|1-63:0| BL:SWS:NREP 1 BL:SWS:REP 1->39|YFHD_BACSU|2e-19|100.0|39/100| SEG 40->62|adaddreaqerakaadnrakkks| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 42-63| PSIPRED cccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccc //