[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yfhI
DDBJ      :yfhI         putative efflux transporter
Swiss-Prot:YFHI_BACSU   RecName: Full=Uncharacterized MFS-type transporter yfhI;

Homologs  Archaea  18/68 : Bacteria  533/915 : Eukaryota  35/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:397 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  10->377 1pw4A  f.38.1.1 * 7e-09 11.7 %
:HMM:SCOP  1->381 1pw4A_ f.38.1.1 * 1.8e-55 25.7 %
:RPS:PFM   33->285 PF07690 * MFS_1 2e-11 27.8 %
:HMM:PFM   15->331 PF07690 * MFS_1 8.1e-38 23.5 315/353  
:BLT:SWISS 1->397 YFHI_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12683.1 GT:GENE yfhI GT:PRODUCT putative efflux transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 926886..928079 GB:FROM 926886 GB:TO 928079 GB:DIRECTION + GB:GENE yfhI GB:PRODUCT putative efflux transporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB12683.1 GB:DB_XREF GOA:O31577 InterPro:IPR011701 SubtiList:BG12884 UniProtKB/Swiss-Prot:O31577 GB:GENE:GENE yfhI LENGTH 397 SQ:AASEQ MSIKNPSVKFIIFVLMICTFSIGYTEYAVMGILTSIANDFHIQVSSAGLLVTAYAASVCLTGPLVTIISVKLPRKPVLLGLMAIFILSNLMSALAPNFAVLAISRILSASIHGAFFAIAMVFASEMVPPEKRAAAAASMNGGLTVALMLGVPFGSYLGDVLNWRAVFSIITALGVIGFLGLMAAVPNRKPKVIPMLMNEWGVFKHKQVLFSFAITILGYSGVFIAYTFIEPILRHSAGFSTVGITGALFAYGLGGVAGNFFAGKVPLPLLTRTMIGVMIGLIGVLAVFPYIAIYPAAAIVATFLFGACAFGTPPLLQTKVISSSEGGTTIAAAVSVSAFNLANALGAWIGGMILNGTGSYSWLFAGGALMTACGLVLSTFAHLSEKKSVYEYQVNKG GT:EXON 1|1-397:0| SW:ID YFHI_BACSU SW:DE RecName: Full=Uncharacterized MFS-type transporter yfhI; SW:GN Name=yfhI; OrderedLocusNames=BSU08540; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->397|YFHI_BACSU|0.0|100.0|397/397| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 12 TM:REGION 4->26| TM:REGION 47->69| TM:REGION 78->100| TM:REGION 107->129| TM:REGION 142->162| TM:REGION 164->185| TM:REGION 206->228| TM:REGION 237->259| TM:REGION 266->288| TM:REGION 297->319| TM:REGION 331->353| TM:REGION 362->384| SEG 286->301|avfpyiaiypaaaiva| RP:PFM:NREP 1 RP:PFM:REP 33->285|PF07690|2e-11|27.8|252/347|MFS_1| HM:PFM:NREP 1 HM:PFM:REP 15->331|PF07690|8.1e-38|23.5|315/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 10->377|1pw4A|7e-09|11.7|368/434|f.38.1.1| HM:SCP:REP 1->381|1pw4A_|1.8e-55|25.7|378/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1731 OP:NHOMOORG 586 OP:PATTERN ------1-11111121--11-------------1-1--1-----21------1--------1------ 111--21333441321111-11--1411111111114853--1-3245233135511411--2-255245-2222422-14---------21-1-------4-11513-2-----------------1---111--121-----2----1-------------------1---------------1-----3-77777754715865884255776561123322222221EA44445434334443384544123-33-22123455333221-4121--------11-------------------------------------22----------2-11--------------231----1-2----------6--1-11-13-54322-12111----------6-22311211281-74434537444542121-3122221-14444444433331--2-------------------------------11-2432267CFACA3444499874445359767884-1765-2311311-5243--1-132-1---------212-------111---12-21111-1----2--111---12121-121111111-----33121221-3-21121121324222--11211-------------44221A35664544455-55455445456565555538B8562234244334333434343954444442-211111111111---------1111--126111-11-11-1---13333324111816745477A267672788112212121-1112-----2231167332332222------122111--------------------------------------1----1---11- ----------------1--1211314---1111---1---------11234-1-22111222----------2-1-----------------1-------2---------------------------------------------------------------------A-------1--------11---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 185-201, 391-393, 396-397| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccc //