[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yfiN
DDBJ      :yfiN         putative ABC transporter (permease)
Swiss-Prot:YFIN_BACSU   RecName: Full=Putative transport permease yfiN;

Homologs  Archaea  0/68 : Bacteria  146/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:385 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   192->352 PF01061 * ABC2_membrane 5e-15 31.2 %
:HMM:PFM   197->351 PF01061 * ABC2_membrane 2.9e-29 27.0 152/208  
:HMM:PFM   83->210 PF01515 * PTA_PTB 0.00094 17.5 126/319  
:BLT:SWISS 1->365 YFIN_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12662.1 GT:GENE yfiN GT:PRODUCT putative ABC transporter (permease) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 907968..909125 GB:FROM 907968 GB:TO 909125 GB:DIRECTION + GB:GENE yfiN GB:PRODUCT putative ABC transporter (permease) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB12662.1 GB:DB_XREF GOA:P94442 InterPro:IPR013525 SubtiList:BG12219 UniProtKB/Swiss-Prot:P94442 GB:GENE:GENE yfiN LENGTH 385 SQ:AASEQ MKKILAICGIELSLIFKKPQNYLIMFAAPLLLTFVFGSMLSGNDDKVRLAIVDQDDTILSQHYIRQLKAHDDMYVFENMSESKASEKLKQKKIAGIIVISRSFQTQLEKGKHPELIFRHGPELSEAPMVKQYAESALATLNIQVTAAKTASQTAGENWKAAYKTVFAKKHEDIVPAVTRQTLSDKKEGAEASDTASRAAGFSILFVMLTMMGAAGTILEARKNGVWSRLLTASVSRAEIGAGYVLSFFVIGWIQFGILLLSTHWLFGINWGNPAAVIVLVSLFLLTVVGIGLMIAANVRTPEQQLAFGNLFVIATCMVSGMYWPIDIEPKFMQSIAEFLPQKWAMSGLTEIIANGARVTDILGICGILLAFAAITFAAGLKALRA GT:EXON 1|1-385:0| SW:ID YFIN_BACSU SW:DE RecName: Full=Putative transport permease yfiN; SW:GN Name=yfiN; OrderedLocusNames=BSU08330; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->365|YFIN_BACSU|0.0|100.0|365/385| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 6 TM:REGION 20->42| TM:REGION 197->219| TM:REGION 241->263| TM:REGION 275->297| TM:REGION 304->325| TM:REGION 361->383| SEG 366->383|gillafaaitfaaglkal| RP:PFM:NREP 1 RP:PFM:REP 192->352|PF01061|5e-15|31.2|160/208|ABC2_membrane| HM:PFM:NREP 2 HM:PFM:REP 197->351|PF01061|2.9e-29|27.0|152/208|ABC2_membrane| HM:PFM:REP 83->210|PF01515|0.00094|17.5|126/319|PTA_PTB| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF01061|IPR013525| OP:NHOMO 173 OP:NHOMOORG 147 OP:PATTERN -------------------------------------------------------------------- -1----------------------1---------------------------1------------1-------------1--------111----------11----------------------1---------1-----2212--------------------------------------------11--32222212122122112111-1221-1--1--------11----1--------------------------------------1111111221-11-----------1111111111111----------1212-1111221-----------------------------11-112------------------------1-----------------------1------111111-11----1--------------------------------------------------------------1---------------------------111-----1-----------------------------1----1-11--------------21--------------------------------------11---------11111-1-111111--111-------------1--1---------------------------------1-1----------------------------------------------------1111------------------------------11------------------1------1------1111-1-11------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 85-86, 146-159| PSIPRED cHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccEEEEEEEcccHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //