[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yfiS
DDBJ      :yfiS         putative efflux transporter
Swiss-Prot:YFIS_BACSU   RecName: Full=Uncharacterized MFS-type transporter yfiS;

Homologs  Archaea  7/68 : Bacteria  279/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:417 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->189 2cfqA PDBj 7e-04 29.6 %
:RPS:SCOP  40->276 1pv6A  f.38.1.2 * 2e-13 15.3 %
:HMM:SCOP  1->405 1pv7A_ f.38.1.2 * 7.6e-52 25.1 %
:RPS:PFM   19->278 PF05977 * DUF894 1e-22 34.8 %
:HMM:PFM   16->294 PF07690 * MFS_1 4.8e-31 26.1 276/353  
:HMM:PFM   250->396 PF07690 * MFS_1 3.9e-12 24.3 140/353  
:BLT:SWISS 1->417 YFIS_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12667.1 GT:GENE yfiS GT:PRODUCT putative efflux transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(912547..913800) GB:FROM 912547 GB:TO 913800 GB:DIRECTION - GB:GENE yfiS GB:PRODUCT putative efflux transporter GB:FUNCTION 16.1: Circulate 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406, 16862575; Product type pt: putative transporter GB:PROTEIN_ID CAB12667.1 GB:DB_XREF GOA:O31561 InterPro:IPR011701 SubtiList:BG12895 UniProtKB/Swiss-Prot:O31561 GB:GENE:GENE yfiS LENGTH 417 SQ:AASEQ MEKPLFRNQKGLMTLLASQTISSLGDWLHILAVLTLAAFQLHASPLDMSLLMMSFALPVIVLGPVSGLLADRFDRKTIMFLSEIGRALTVISCVYVSELWQLYVLLSVQSCFSSLFLPAKNGKLKELAPEAHIQQAVSVSSIIDNSSKIFGPALGGTLIAAFSIHSVFYINAGAFFLSAVILFFLPRDAFLQKANTPQEKTAALTSIKEGLQFLKRMPLLLTGLLTACVVLFVLQIGDSQAIILIRSFSGAPPELAGWCMAVSGAGMLLTAAITGRRRITSYLLYFSAGTLLLGLATGGAPFLSGMGIAGITLFIFAFFIMGAAFGLVHIPFQILVQTTVPVDYSGRVFGAIQSATTLASILGMAGGGVLAEWIGVSLAFLVCGCLLIMIGLITLIGKKIAESRRYLVTKSNKGAQG GT:EXON 1|1-417:0| SW:ID YFIS_BACSU SW:DE RecName: Full=Uncharacterized MFS-type transporter yfiS; SW:GN Name=yfiS; OrderedLocusNames=BSU08380; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->417|YFIS_BACSU|0.0|100.0|417/417| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 10 TM:REGION 15->37| TM:REGION 49->71| TM:REGION 100->122| TM:REGION 170->192| TM:REGION 220->242| TM:REGION 254->275| TM:REGION 280->302| TM:REGION 313->335| TM:REGION 350->372| TM:REGION 376->397| SEG 288->300|agtlllglatgga| SEG 314->326|fifaffimgaafg| SEG 381->400|lvcgcllimiglitligkki| BL:PDB:NREP 1 BL:PDB:REP 42->189|2cfqA|7e-04|29.6|142/417| RP:PFM:NREP 1 RP:PFM:REP 19->278|PF05977|1e-22|34.8|253/402|DUF894| HM:PFM:NREP 2 HM:PFM:REP 16->294|PF07690|4.8e-31|26.1|276/353|MFS_1| HM:PFM:REP 250->396|PF07690|3.9e-12|24.3|140/353|MFS_1| RP:SCP:NREP 1 RP:SCP:REP 40->276|1pv6A|2e-13|15.3|236/417|f.38.1.2| HM:SCP:REP 1->405|1pv7A_|7.6e-52|25.1|394/417|f.38.1.2|1/1|MFS general substrate transporter| OP:NHOMO 567 OP:NHOMOORG 290 OP:PATTERN --------------------------------------------1-----21--1---111------- 147-3---111--11----------1-----------12121-111--111-3111----22--5-1112------------------11---1-------1-1-11---1111111--------111-1--11-111224---625113111----1------22-3421-1---------------2--224888998992AC968C541-32998-1-3312------D21--------------1---1-121111----11--22----1-----------1-------1--1------1--------2---------23212----------1-44------1--1---143211-1-1111121--1111----11-2--1----1---1------------------1---3---------1--11--1---11-----1-----------1---------------------------------1-11-1-1----133231-111122211111112121314----1-1---112-2----1-------11111---1---1--1----------1--1-1--1----5---1---1----11---------1------1------------------------------------------1113-1-------------------------------111-1-1-----------------2---------111111111111----------------11----------------------11----11----1-1-----11---------------------------1-11---------------------------1-------------------------214112122211- ----11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 34.1 SQ:SECSTR #########################################cccTTTcHHHHHHHHHHHHHHHHHHHHHHTTcTccHHHHH##HHHTTccHHHHHHHHHHHTTcc##HHHHGGGccTTHHHTTHH##HHHHHHHHHHHHHTccHHHHcccTTHHHHHHHHHHHHccHHTTTTTTTTTHHHHcccccccc#################################################################################################################################################################################################################################### DISOP:02AL 187-205, 406-417| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccc //