[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yfkS
DDBJ      :yfkS         hypothetical protein
Swiss-Prot:YFKS_BACSU   RecName: Full=Uncharacterized protein yfkS;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->41 PF01252 * Peptidase_A8 0.00044 16.2 37/150  
:HMM:PFM   33->62 PF09678 * Caa3_CtaG 0.00098 26.7 30/244  
:BLT:SWISS 1->66 YFKS_BACSU 4e-36 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12606.1 GT:GENE yfkS GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(847282..847482) GB:FROM 847282 GB:TO 847482 GB:DIRECTION - GB:GENE yfkS GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12606.1 GB:DB_XREF GOA:O35036 SubtiList:BG12934 UniProtKB/Swiss-Prot:O35036 GB:GENE:GENE yfkS LENGTH 66 SQ:AASEQ MISYIVQTLIVCIAIYAYEWKNFRSANNLTKWAFSLLIAGSAFLWIYMRVNPLLPRLGHLFKYIPF GT:EXON 1|1-66:0| SW:ID YFKS_BACSU SW:DE RecName: Full=Uncharacterized protein yfkS; SW:GN Name=yfkS; OrderedLocusNames=BSU07770; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|YFKS_BACSU|4e-36|100.0|66/100| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 1->23| TM:REGION 28->50| HM:PFM:NREP 2 HM:PFM:REP 4->41|PF01252|0.00044|16.2|37/150|Peptidase_A8| HM:PFM:REP 33->62|PF09678|0.00098|26.7|30/244|Caa3_CtaG| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-46,48-48| PSIPRED cHHHHHHHHHHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccc //