[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yflB
DDBJ      :yflB         conserved hypothetical protein
Swiss-Prot:YFLB_BACSU   RecName: Full=Uncharacterized protein yflB;

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->90 PF09350 * DUF1992 3e-10 41.7 %
:HMM:PFM   8->76 PF09350 * DUF1992 4.8e-24 42.0 69/71  
:BLT:SWISS 1->130 YFLB_BACSU 1e-64 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12603.2 GT:GENE yflB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 844253..844645 GB:FROM 844253 GB:TO 844645 GB:DIRECTION + GB:GENE yflB GB:PRODUCT conserved hypothetical protein GB:FUNCTION 18: Unknown function GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12603.2 GB:DB_XREF InterPro:IPR018961 SubtiList:BG12937 UniProtKB/Swiss-Prot:O34887 GB:GENE:GENE yflB LENGTH 130 SQ:AASEQ MDFSHIVSEDKIKRAIKDGDFQNLPGMGKPLPKDDAAHLPESLRMGYRILKNAGMAEDEGALKKELMTIDHLIEKCYDEKEREQLIRKKSEKQLLLDKLVDKKGMFSKPASAFYKNKVYDRLGRNRPSSS GT:EXON 1|1-130:0| SW:ID YFLB_BACSU SW:DE RecName: Full=Uncharacterized protein yflB; SW:GN Name=yflB; OrderedLocusNames=BSU07740; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->130|YFLB_BACSU|1e-64|100.0|130/130| SEG 92->103|kqllldklvdkk| RP:PFM:NREP 1 RP:PFM:REP 7->90|PF09350|3e-10|41.7|84/92|DUF1992| HM:PFM:NREP 1 HM:PFM:REP 8->76|PF09350|4.8e-24|42.0|69/71|DUF1992| OP:NHOMO 76 OP:NHOMOORG 74 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1111111111111111-11111111111-----------1-----------------------------------------------------------------------------------------------------------------------------211--11---------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-1-11-1111------1----------1-------------------------------------------------------------11-------11----1---------------1-------1-----1111-1--11-11111111-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 130-131| PSIPRED cHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccc //