[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yflL
DDBJ      :yflL         putative acylphosphatase
Swiss-Prot:ACYP_BACSU   RecName: Full=Acylphosphatase;         EC=3.6.1.7;AltName: Full=Acylphosphate phosphohydrolase;

Homologs  Archaea  28/68 : Bacteria  218/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
d.58.10
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->91 2fhmA PDBj 2e-49 100.0 %
:RPS:PDB   1->90 3br8A PDBj 5e-25 100.0 %
:RPS:SCOP  1->88 1gxtA  d.58.10.1 * 5e-22 29.4 %
:HMM:SCOP  1->90 1apsA_ d.58.10.1 * 1.7e-28 45.6 %
:RPS:PFM   1->89 PF00708 * Acylphosphatase 2e-15 42.7 %
:HMM:PFM   1->88 PF00708 * Acylphosphatase 9.1e-33 45.5 88/91  
:BLT:SWISS 1->91 ACYP_BACSU 6e-49 100.0 %
:PROS 8->18|PS00150|ACYLPHOSPHATASE_1
:PROS 32->48|PS00151|ACYLPHOSPHATASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12593.1 GT:GENE yflL GT:PRODUCT putative acylphosphatase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(837735..838010) GB:FROM 837735 GB:TO 838010 GB:DIRECTION - GB:GENE yflL GB:PRODUCT putative acylphosphatase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.8: Protect 16.6: Maintain GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12593.1 GB:DB_XREF GOA:O35031 InterPro:IPR017968 PDB:2FHM SubtiList:BG12947 UniProtKB/Swiss-Prot:O35031 GB:GENE:GENE yflL LENGTH 91 SQ:AASEQ MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS GT:EXON 1|1-91:0| SW:ID ACYP_BACSU SW:DE RecName: Full=Acylphosphatase; EC=3.6.1.7;AltName: Full=Acylphosphate phosphohydrolase; SW:GN Name=acyP; Synonyms=yflL; OrderedLocusNames=BSU07640; SW:KW 3D-structure; Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->91|ACYP_BACSU|6e-49|100.0|91/91| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| PROS 8->18|PS00150|ACYLPHOSPHATASE_1|PDOC00136| PROS 32->48|PS00151|ACYLPHOSPHATASE_2|PDOC00136| BL:PDB:NREP 1 BL:PDB:REP 1->91|2fhmA|2e-49|100.0|91/91| RP:PDB:NREP 1 RP:PDB:REP 1->90|3br8A|5e-25|100.0|90/90| RP:PFM:NREP 1 RP:PFM:REP 1->89|PF00708|2e-15|42.7|89/90|Acylphosphatase| HM:PFM:NREP 1 HM:PFM:REP 1->88|PF00708|9.1e-33|45.5|88/91|Acylphosphatase| RP:SCP:NREP 1 RP:SCP:REP 1->88|1gxtA|5e-22|29.4|85/88|d.58.10.1| HM:SCP:REP 1->90|1apsA_|1.7e-28|45.6|90/0|d.58.10.1|1/1|Acylphosphatase/BLUF domain-like| OP:NHOMO 269 OP:NHOMOORG 265 OP:PATTERN ------1-11111111--111-111--111-1----1----------2---1---1-1111------1 11-------------------------------------------1----------------1------------111----1--111-----------------1--1----------------11-111--1-1-1-1111--11111----------------111--------------1-111-1--11---------------1-1111---111---1111111-----------------1--1-11----111-1--11--11111-111--------1--------------------------------------11---------1-----111--------11------1-1-----1---1----1-------111-11----1------------11-1-111--------11-11----1---------------------1------1--------------------------------1--1-----------------11--------1--11-----1------------12----------------11---1-----1-111--------1-1----1-11--------------------11------1--------1-----------1----11----1--------111111111111111---1111111111111111111-11-1---1111111111111111-11111-1---------------------------11---111111------------------------------------------------1------------------------------111----11--1-1-1----------------------------1---11111--- --------21------1------------1-------111111-------1----1--1-11----------------------------1-1------------------------------------------------------------------------------------------------11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEEEcccccHHHHHHHHHHHTTcEEEEEEcTTccEEEEEEEcHHHHHHHHHHHHHccTTcEEEEEEEEEEccccccccEEEccc DISOP:02AL 91-92| PSIPRED cEEEEEEEEEEEccccHHHHHHHHHHHcccEEEEEEccccEEEEEEEccHHHHHHHHHHHHHcccHHEEEEEEEEEcccccccccEEEEEc //