[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ygaF
DDBJ      :ygaF         putative bacterioferritin comigratory protein; putative peroxiredoxin
Swiss-Prot:BCP_BACSU    RecName: Full=Putative peroxiredoxin ygaF;         EC=1.11.1.15;AltName: Full=Thioredoxin reductase;AltName: Full=Bacterioferritin comigratory protein;

Homologs  Archaea  61/68 : Bacteria  754/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->139 3gkmA PDBj 7e-29 43.8 %
:RPS:PDB   2->152 2bmxA PDBj 2e-27 27.2 %
:RPS:SCOP  3->154 1psqA  c.47.1.10 * 2e-36 20.8 %
:HMM:SCOP  1->154 1x0rA1 c.47.1.10 * 2.8e-56 43.8 %
:RPS:PFM   5->131 PF00578 * AhpC-TSA 6e-25 47.5 %
:HMM:PFM   5->132 PF00578 * AhpC-TSA 2.3e-45 48.4 122/124  
:BLT:SWISS 1->157 BCP_BACSU 4e-91 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12700.2 GT:GENE ygaF GT:PRODUCT putative bacterioferritin comigratory protein; putative peroxiredoxin GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 943891..944364 GB:FROM 943891 GB:TO 944364 GB:DIRECTION + GB:GENE ygaF GB:PRODUCT putative bacterioferritin comigratory protein; putative peroxiredoxin GB:FUNCTION 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 10644761, 11349039, 12950915; Product type pe: putative enzyme GB:PROTEIN_ID CAB12700.2 GB:DB_XREF GOA:Q796Y8 InterPro:IPR012335 SubtiList:BG12226 UniProtKB/Swiss-Prot:Q796Y8 GB:GENE:GENE ygaF LENGTH 157 SQ:AASEQ MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK GT:EXON 1|1-157:0| SW:ID BCP_BACSU SW:DE RecName: Full=Putative peroxiredoxin ygaF; EC=1.11.1.15;AltName: Full=Thioredoxin reductase;AltName: Full=Bacterioferritin comigratory protein; SW:GN Name=ygaF; Synonyms=bcp; OrderedLocusNames=BSU08720; SW:KW Complete proteome; Oxidoreductase; Peroxidase; Redox-active center. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|BCP_BACSU|4e-91|100.0|157/157| GO:SWS:NREP 3 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0004601|"GO:peroxidase activity"|Peroxidase| BL:PDB:NREP 1 BL:PDB:REP 3->139|3gkmA|7e-29|43.8|137/157| RP:PDB:NREP 1 RP:PDB:REP 2->152|2bmxA|2e-27|27.2|147/168| RP:PFM:NREP 1 RP:PFM:REP 5->131|PF00578|6e-25|47.5|120/122|AhpC-TSA| HM:PFM:NREP 1 HM:PFM:REP 5->132|PF00578|2.3e-45|48.4|122/124|AhpC-TSA| GO:PFM:NREP 2 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| RP:SCP:NREP 1 RP:SCP:REP 3->154|1psqA|2e-36|20.8|144/163|c.47.1.10| HM:SCP:REP 1->154|1x0rA1|2.8e-56|43.8|146/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 1837 OP:NHOMOORG 993 OP:PATTERN 441121534444444423333-1-2224223---111111211-111212312-12123446441122 3252222111112133333-32223333333322224443132511211222343213--22213334442-111111-1122313341121-1111--1-2221832-211111111111111143333233343111211114-53554446555444444334555544425444445443341132-2211111111111211121111111112221111------3311111111111111111111--1-11-1-----1111----1----111-1-1------------------------------------113113-------1-1-2---111213111111-------11--223-3--21211121111122122221121221111111-111-1111211111111111112111112111221-1111111222222221224-1211111111111141111-1111-11-111112132122222222222211111122111111223111111111111111111111123524111111111112323312--113-12221-21312331132144511111111111111111111111112111112221322212222223322223133233--122111-----11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-322222222221222111111111111111111111311112333321111223211111----1---21112222221112211111111111111112-223333-------------------1--------1-------323333133331- 1111D6--883---2-2211111111--111111111111111-1111112222111-1-1111111112111221111111112122-3122212222311132--2-2458325221112226313-9B5-32512-1413321221131-2211321-223322333313334542E422254234133227695- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 100.0 SQ:SECSTR cEccccGGGcccccGGGGEEEEETTccTTcEEEEEEcccTTccccHHHHHHHHHTHHHHHTTTEEEEEEEcccHHHHHHHHHHcTTGGGccEcTTccEEcTTcHHHHHHTcccTTccccEEEEEEcTTccEEEEEEETTccccHHHHHHHHHHHHHT DISOP:02AL 157-158| PSIPRED cccccccccccEEEEcccccEEEHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccEEEEEccccHHHHHccccccccccccccccccEEEEEEccccEEEEEEccccccccHHHHHHHHHHHHcc //