[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ygaJ
DDBJ      :ygaJ         putative peptidase
Swiss-Prot:YGAJ_BACSU   RecName: Full=Uncharacterized peptidase ygaJ;         EC=3.4.21.-;

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   75->127 1fy2A PDBj 3e-04 37.7 %
:RPS:PDB   28->62 2ddiA PDBj 1e-05 20.0 %
:RPS:SCOP  34->194 1fy2A  c.23.16.4 * 5e-08 19.1 %
:HMM:SCOP  1->200 1fyeA_ c.23.16.4 * 9.1e-31 27.8 %
:RPS:PFM   58->165 PF03575 * Peptidase_S51 3e-14 40.2 %
:HMM:PFM   49->196 PF03575 * Peptidase_S51 5.2e-47 39.2 148/153  
:BLT:SWISS 1->230 YGAJ_BACSU e-136 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12706.2 GT:GENE ygaJ GT:PRODUCT putative peptidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 954893..955585 GB:FROM 954893 GB:TO 955585 GB:DIRECTION + GB:GENE ygaJ GB:PRODUCT putative peptidase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12706.2 GB:DB_XREF GOA:P71089 InterPro:IPR005320 SubtiList:BG12230 UniProtKB/Swiss-Prot:P71089 GB:GENE:GENE ygaJ LENGTH 230 SQ:AASEQ MKQIIAMGGGGFSMEPDNLSLDQYILNQSKREQPRICFLPTASGDSQNYIQRFYHAFQTLDCVPSHLSLFKPPSSDLVSFVMEMDVIYVGGGNTRNLLVLWKEWGLDHILREAWKNGVVVAGISAGAICWFEEGVTDSAGPLTSLKSLGFLQGSFCPHYDGEKDRRPAYHQLISNKFLCSGYAADDGAALHFINDQLFQTVSSRSGAKAYRVMMAEHEIAEIPLPVKYLG GT:EXON 1|1-230:0| SW:ID YGAJ_BACSU SW:DE RecName: Full=Uncharacterized peptidase ygaJ; EC=3.4.21.-; SW:GN Name=ygaJ; OrderedLocusNames=BSU08780; SW:KW Complete proteome; Hydrolase; Protease; Serine protease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->230|YGAJ_BACSU|e-136|100.0|230/230| GO:SWS:NREP 3 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0008236|"GO:serine-type peptidase activity"|Serine protease| BL:PDB:NREP 1 BL:PDB:REP 75->127|1fy2A|3e-04|37.7|53/220| RP:PDB:NREP 1 RP:PDB:REP 28->62|2ddiA|1e-05|20.0|35/70| RP:PFM:NREP 1 RP:PFM:REP 58->165|PF03575|3e-14|40.2|107/150|Peptidase_S51| HM:PFM:NREP 1 HM:PFM:REP 49->196|PF03575|5.2e-47|39.2|148/153|Peptidase_S51| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF03575|IPR005320| GO:PFM GO:0008236|"GO:serine-type peptidase activity"|PF03575|IPR005320| RP:SCP:NREP 1 RP:SCP:REP 34->194|1fy2A|5e-08|19.1|157/220|c.23.16.4| HM:SCP:REP 1->200|1fyeA_|9.1e-31|27.8|194/0|c.23.16.4|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 66 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1----1111111----1-1--1--11-11---1-----------------------------------------------------------------------------1------------------------1--1111-11-1----------111111111111111111---11111--11------------------------------------------------------------------------------------------------------1-------------------------1--------------111-1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------- --------21---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 44.3 SQ:SECSTR #########################ccccccccccGGGcccccccccccEEEEEEEGGGTEEEEcccTTccGGGccEEEEcTTccTTTcTTTTccTTHHHccTTHHHHHHHHHHHTTccEEEEGGGH####################################################################################################### DISOP:02AL 230-231| PSIPRED ccEEEEEcccccccccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHccEEEEccccHHHHHHHHHHccHHHHHHHHHHcccEEEEEcccHHHccccccccccccccccccccccccEEcccccccccHHHHHHHHHHccccccEEEcccccEEEEEccEEEEEEEccccccEEEEEEEccEEEEEEccccccc //