[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ygaN
DDBJ      :ygaN         putative sulfur oxidoreductase
Swiss-Prot:YGAN_BACSU   RecName: Full=Uncharacterized protein ygaN;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   77->130 PF01404 * Ephrin_lbd 0.00033 25.9 54/178  
:BLT:SWISS 1->178 YGAN_BACSU e-101 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12715.1 GT:GENE ygaN GT:PRODUCT putative sulfur oxidoreductase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 965261..965797 GB:FROM 965261 GB:TO 965797 GB:DIRECTION + GB:GENE ygaN GB:PRODUCT putative sulfur oxidoreductase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12715.1 GB:DB_XREF SubtiList:BG12233 UniProtKB/Swiss-Prot:P97028 GB:GENE:GENE ygaN LENGTH 178 SQ:AASEQ MLSACGHSKQMEIKAADISDLEKNRMDVAASQAFTAEAVNIGEGISSADMYIEHYQKGKLVERFGPVRADYSEEKTDTIQFVYFENEEGEGKNKHTTIHFGIVDKQGTIAADSSVKRDDSTTQEMTQNISSPEPITFEKPALIGSSIRGTDETMHTSEHKKELIKHQDALLYYVELHH GT:EXON 1|1-178:0| SW:ID YGAN_BACSU SW:DE RecName: Full=Uncharacterized protein ygaN; SW:GN Name=ygaN; OrderedLocusNames=BSU08870; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->178|YGAN_BACSU|e-101|100.0|178/100| HM:PFM:NREP 1 HM:PFM:REP 77->130|PF01404|0.00033|25.9|54/178|Ephrin_lbd| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 116-128| PSIPRED cccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHcccccccccccccEEEEEEEEcccccccccEEEEEEEEEcccccEEccccccccccHHHHHHHHccccccEEEccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEcc //