[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ygaO
DDBJ      :ygaO         putative integral inner membrane protein
Swiss-Prot:YGAO_BACSU   RecName: Full=Uncharacterized lipoprotein ygaO;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:157 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   52->149 PF11368 * DUF3169 1.1e-06 19.4 98/248  
:BLT:SWISS 1->157 YGAO_BACSU 3e-76 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12717.1 GT:GENE ygaO GT:PRODUCT putative integral inner membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(966196..966669) GB:FROM 966196 GB:TO 966669 GB:DIRECTION - GB:GENE ygaO GB:PRODUCT putative integral inner membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB12717.1 GB:DB_XREF GOA:P97029 SubtiList:BG12234 UniProtKB/Swiss-Prot:P97029 GB:GENE:GENE ygaO LENGTH 157 SQ:AASEQ MSMKTKAAFHLVLFGLACWALISYFEASEGIASFFGTKSGGMVFDLNLTPFILFVAASAVYLYLQKKSRPARKQLLLPDEFEEQDEREQMMTAKACRASYIAVYFSLPAAAVLLIFYPLFQSRIPFFPIIIVFIIMIIQHLSYVISFKKNEKNSGAL GT:EXON 1|1-157:0| SW:ID YGAO_BACSU SW:DE RecName: Full=Uncharacterized lipoprotein ygaO;Flags: Precursor; SW:GN Name=ygaO; OrderedLocusNames=BSU08890; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->157|YGAO_BACSU|3e-76|100.0|157/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 6->28| TM:REGION 44->65| TM:REGION 98->120| TM:REGION 125->147| SEG 124->138|ipffpiiivfiimii| HM:PFM:NREP 1 HM:PFM:REP 52->149|PF11368|1.1e-06|19.4|98/248|DUF3169| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-11-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 153-157| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHHHHHHHccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccc //