[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ygzB
DDBJ      :ygzB         putative membrane protein
Swiss-Prot:YGZB_BACSU   RecName: Full=UPF0295 protein ygzB;

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->113 PF11023 * DUF2614 4e-38 68.8 %
:HMM:PFM   3->114 PF11023 * DUF2614 1.5e-62 74.1 112/114  
:BLT:SWISS 1->117 YGZB_BACSU 1e-53 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAE01450.1 GT:GENE ygzB GT:PRODUCT putative membrane protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(944959..945312) GB:FROM 944959 GB:TO 945312 GB:DIRECTION - GB:GENE ygzB GB:PRODUCT putative membrane protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAE01450.1 GB:DB_XREF GOA:Q7WY74 SubtiList:BG14192 UniProtKB/Swiss-Prot:Q7WY74 GB:GENE:GENE ygzB LENGTH 117 SQ:AASEQ MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGVVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK GT:EXON 1|1-117:0| SW:ID YGZB_BACSU SW:DE RecName: Full=UPF0295 protein ygzB; SW:GN Name=ygzB; OrderedLocusNames=BSU08740; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->117|YGZB_BACSU|1e-53|100.0|117/117| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 12->34| TM:REGION 40->62| SEG 37->53|llsslfmilgllsigls| RP:PFM:NREP 1 RP:PFM:REP 5->113|PF11023|4e-38|68.8|109/114|DUF2614| HM:PFM:NREP 1 HM:PFM:REP 3->114|PF11023|1.5e-62|74.1|112/114|DUF2614| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111-11111111------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 107-117| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccccEEEEEEccccccEEEEEEEEHHHccccccccccccccccHHHHHccccccc //