[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhaI
DDBJ      :yhaI         conserved hypothetical protein
Swiss-Prot:YHAI_BACSU   RecName: Full=Uncharacterized protein yhaI;

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.219.1
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->113 1sedA PDBj 9e-62 100.0 %
:RPS:SCOP  2->113 1sedA  a.219.1.1 * 5e-09 100.0 %
:HMM:SCOP  2->113 1sedA_ a.219.1.1 * 2.1e-50 65.2 %
:RPS:PFM   3->109 PF08963 * DUF1878 1e-21 45.8 %
:HMM:PFM   1->113 PF08963 * DUF1878 6.8e-55 65.5 113/113  
:BLT:SWISS 1->113 YHAI_BACSU 7e-62 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12838.1 GT:GENE yhaI GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1072768..1073109 GB:FROM 1072768 GB:TO 1073109 GB:DIRECTION + GB:GENE yhaI GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12838.1 GB:DB_XREF InterPro:IPR015058 PDB:1SED SubtiList:BG12985 UniProtKB/Swiss-Prot:O07517 GB:GENE:GENE yhaI LENGTH 113 SQ:AASEQ MDSMDHRIERLEYYIQLLVKTVDMDRYPFYALLIDKGLSKEEGEAVMRICDELSEELATQKAQGFVTFDKLLALFAGQLNEKLDVHETIFALYEQGLYQELMEVFIDIMKHFD GT:EXON 1|1-113:0| SW:ID YHAI_BACSU SW:DE RecName: Full=Uncharacterized protein yhaI; SW:GN Name=yhaI; OrderedLocusNames=BSU09980; SW:KW 3D-structure; Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->113|YHAI_BACSU|7e-62|100.0|113/100| BL:PDB:NREP 1 BL:PDB:REP 2->113|1sedA|9e-62|100.0|112/112| RP:PFM:NREP 1 RP:PFM:REP 3->109|PF08963|1e-21|45.8|107/111|DUF1878| HM:PFM:NREP 1 HM:PFM:REP 1->113|PF08963|6.8e-55|65.5|113/113|DUF1878| RP:SCP:NREP 1 RP:SCP:REP 2->113|1sedA|5e-09|100.0|112/112|a.219.1.1| HM:SCP:REP 2->113|1sedA_|2.1e-50|65.2|112/112|a.219.1.1|1/1|Hypothetical protein YhaI| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111--1111111111---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 99.1 SQ:SECSTR #cTHHHHHHHHHHHHHHHHTTccTTTcHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHccTTccHHHHHHHHHHTTccHHHHHHHHHHHHHHc DISOP:02AL 1-5| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //