[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhaJ
DDBJ      :yhaJ         putative bacteriocin
Swiss-Prot:YHAJ_BACSU   RecName: Full=Uncharacterized membrane protein yhaJ;

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   57->159 PF11667 * DUF3267 5.6e-25 29.4 102/111  
:BLT:SWISS 1->172 YHAJ_BACSU 8e-89 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12837.2 GT:GENE yhaJ GT:PRODUCT putative bacteriocin GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1072042..1072560) GB:FROM 1072042 GB:TO 1072560 GB:DIRECTION - GB:GENE yhaJ GB:PRODUCT putative bacteriocin GB:FUNCTION 16.5: Explore 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 16845009; Product type pf : putative factor GB:PROTEIN_ID CAB12837.2 GB:DB_XREF GOA:O07518 SubtiList:BG12986 UniProtKB/Swiss-Prot:O07518 GB:GENE:GENE yhaJ LENGTH 172 SQ:AASEQ MNCWKTINLMKDYGAVRIILTAVCFMILVFISTFLAFELLRPGTSLSDEYVSLFGGLLVVILFVHKVIHVLPIICKKRKIEKKFYILRMRTWKRIPKTTMLISLVSPFLLITPVLFYAALAFPNHAHYFCMISGIHAGYCLPDFLLALKLIKAPKTAFIDQEADGLDILVEK GT:EXON 1|1-172:0| SW:ID YHAJ_BACSU SW:DE RecName: Full=Uncharacterized membrane protein yhaJ; SW:GN Name=yhaJ; OrderedLocusNames=BSU09965; ORFNames=BSU09960/BSU09970; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->172|YHAJ_BACSU|8e-89|100.0|172/100| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 18->40| TM:REGION 52->74| TM:REGION 98->120| TM:REGION 129->151| SEG 51->64|vslfggllvvilfv| HM:PFM:NREP 1 HM:PFM:REP 57->159|PF11667|5.6e-25|29.4|102/111|DUF3267| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------11111------11-----111--1111111111111111---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 172-173| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHEEc //