[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhaZ
DDBJ      :yhaZ         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.1
:357 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   128->228 2db0A PDBj 3e-05 10.5 %
:RPS:SCOP  122->209 2b6cA1  a.118.1.17 * 1e-15 17.5 %
:HMM:SCOP  15->236 2b6cA1 a.118.1.17 * 5e-47 33.5 %
:RPS:PFM   101->232 PF08713 * DNA_alkylation 6e-15 43.4 %
:HMM:PFM   119->213 PF08713 * DNA_alkylation 3.7e-10 29.1 86/213  
:BLT:SWISS 36->79 DGTP_KLEP7 8e-04 50.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12820.1 GT:GENE yhaZ GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1055143..1056216) GB:FROM 1055143 GB:TO 1056216 GB:DIRECTION - GB:GENE yhaZ GB:PRODUCT conserved hypothetical protein GB:FUNCTION 16.6: Maintain GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function; PubMedId: 16267290 GB:PROTEIN_ID CAB12820.1 GB:DB_XREF GOA:O07541 InterPro:IPR000357 SubtiList:BG13002 UniProtKB/TrEMBL:O07541 GB:GENE:GENE yhaZ LENGTH 357 SQ:AASEQ MADLKEIYNEELISQLIHHVRSSYPDFNKNRFLDTLRLEDWPELTLKERMRRVTVSLYETLPKQYVEALTILRDTAPHFKGLSGILFPDYVEQYGLAHWEESIKALESFTQYSTSEFAVRPFLLLDQEKMIAQLLAWSEHKNEHVRRLASEGSRPRLPWGKSIPALKSDPSPVLPILEKLMQDESLYVRKSVANNLNDISKTHPHLLRKVADQWYGTHPHTDWIIKHAYRTLLKKGDKQALALFGYENADSIQLHDLTCQPKRIVIGESLEFSFYIHSDRDQKVRIEYAIDFVKARGQRHQKVFKITETNIRKNETKSYTRIQSFKDLTTRKHYKGIHTLSVIINGEVKDSLDFQVC GT:EXON 1|1-357:0| BL:SWS:NREP 1 BL:SWS:REP 36->79|DGTP_KLEP7|8e-04|50.0|44/100| RP:PDB:NREP 1 RP:PDB:REP 128->228|2db0A|3e-05|10.5|95/239| RP:PFM:NREP 1 RP:PFM:REP 101->232|PF08713|6e-15|43.4|122/202|DNA_alkylation| HM:PFM:NREP 1 HM:PFM:REP 119->213|PF08713|3.7e-10|29.1|86/213|DNA_alkylation| RP:SCP:NREP 1 RP:SCP:REP 122->209|2b6cA1|1e-15|17.5|80/213|a.118.1.17| HM:SCP:REP 15->236|2b6cA1|5e-47|33.5|206/0|a.118.1.17|1/1|ARM repeat| OP:NHOMO 87 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- -------------------------------------1----------1-----1-----1---1------------------------------------2---11-------------------------------------1----1-------------------------------------------1111111-1-1111-1----11112---2-1--------1----------------------1--------------1------------------------------------------1----------1--1-----------1---------------------------------1-1-------------------1----------------1--1-------11-11-111---------------11------------1-11---------------------------------1---------------------------------------1----11-21-----------------------1-------1-------------------21--1-----------1--------------------1---1------------------------------------------------------------------------------------------------------------------------------------1--------------1-----------------111------------------1---1----------11--------------1-11--11------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 29.1 SQ:SECSTR ############################################################################################################################ccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHcHHHHHHHHHHHHHHTccccHHHHHHHHHHHHTccTTTHHHHGGGHHHHHGGGGcccHHHHHH################################################################################################################################# PSIPRED ccHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHccHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHcccccccEEEEEEEccccEEEEccEEEEEEEEEcccccEEEEEEEEEEEccccccccEEEEEEEEEEccccEEEEEEccccccccccEEEcccEEEEEEEccEEccccccccc //