[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhbA
DDBJ      :yhbA         putative iron-sulfur containing oxidoreductase subunit
Swiss-Prot:YHBA_BACSU   RecName: Full=Putative electron transport protein yhbA;

Homologs  Archaea  8/68 : Bacteria  535/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.1.2a.118.1a.160.1
:386 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   316->343 2qnaA PDBj 2e-04 63.0 %
:RPS:PDB   142->320 1d0cA PDBj 3e-08 14.0 %
:RPS:PDB   313->347 3ea5B PDBj 2e-04 20.6 %
:RPS:SCOP  5->62 1px5A1  a.160.1.2 * 1e-06 24.1 %
:RPS:SCOP  115->248 1gt8A1  a.1.2.2 * 6e-10 11.2 %
:RPS:SCOP  300->346 1te4A  a.118.1.16 * 3e-06 35.6 %
:HMM:SCOP  134->250 2bs2B1 a.1.2.1 * 3.8e-17 29.9 %
:HMM:SCOP  262->375 1te4A_ a.118.1.16 * 6.4e-13 32.4 %
:RPS:PFM   57->123 PF08331 * DUF1730 5e-06 29.9 %
:HMM:PFM   57->135 PF08331 * DUF1730 8e-29 45.5 77/78  
:HMM:PFM   333->357 PF03130 * HEAT_PBS 8.1e-07 40.0 25/27  
:HMM:PFM   184->203 PF00037 * Fer4 1.3e-06 40.0 20/24  
:HMM:PFM   313->341 PF00514 * Arm 0.00025 32.1 28/41  
:BLT:SWISS 1->386 YHBA_BACSU 0.0 100.0 %
:PROS 188->199|PS00198|4FE4S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12719.2 GT:GENE yhbA GT:PRODUCT putative iron-sulfur containing oxidoreductase subunit GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 967935..969095 GB:FROM 967935 GB:TO 969095 GB:DIRECTION + GB:GENE yhbA GB:PRODUCT putative iron-sulfur containing oxidoreductase subunit GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12719.2 GB:DB_XREF GOA:P97030 InterPro:IPR004155 SubtiList:BG12236 UniProtKB/Swiss-Prot:P97030 GB:GENE:GENE yhbA LENGTH 386 SQ:AASEQ MNVYQLKEELIEYAKSIGVDKIGFTTADTFDSLKDRLILQESLGYLSGFEEPDIEKRVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLLEDFLKSKHEDIRTKSMVDTGELSDRAVAERAGIGFSAKNCMITTPEYGSYVYLAEMITNIPFEPDVPIEDMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQTVCPLNKGKDFHLHPEMEPDPEIAKPLLKPLLAISNREFKEKFGHVSGSWRGKKPIQRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEKEKDEEAKLEIEKGIELLKASGMTKQGLS GT:EXON 1|1-386:0| SW:ID YHBA_BACSU SW:DE RecName: Full=Putative electron transport protein yhbA; SW:GN Name=yhbA; Synonyms=ygaP; OrderedLocusNames=BSU08910; SW:KW 4Fe-4S; Complete proteome; Electron transport; Iron; Iron-sulfur;Metal-binding; Repeat; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->386|YHBA_BACSU|0.0|100.0|386/386| GO:SWS:NREP 5 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 188->199|PS00198|4FE4S_FER_1|PDOC00176| SEG 349->370|aeelekalekekdeeakleiek| BL:PDB:NREP 1 BL:PDB:REP 316->343|2qnaA|2e-04|63.0|27/744| RP:PDB:NREP 2 RP:PDB:REP 142->320|1d0cA|3e-08|14.0|172/416| RP:PDB:REP 313->347|3ea5B|2e-04|20.6|34/859| RP:PFM:NREP 1 RP:PFM:REP 57->123|PF08331|5e-06|29.9|67/79|DUF1730| HM:PFM:NREP 4 HM:PFM:REP 57->135|PF08331|8e-29|45.5|77/78|DUF1730| HM:PFM:REP 333->357|PF03130|8.1e-07|40.0|25/27|HEAT_PBS| HM:PFM:REP 184->203|PF00037|1.3e-06|40.0|20/24|Fer4| HM:PFM:REP 313->341|PF00514|0.00025|32.1|28/41|Arm| RP:SCP:NREP 3 RP:SCP:REP 5->62|1px5A1|1e-06|24.1|58/146|a.160.1.2| RP:SCP:REP 115->248|1gt8A1|6e-10|11.2|134/182|a.1.2.2| RP:SCP:REP 300->346|1te4A|3e-06|35.6|45/111|a.118.1.16| HM:SCP:REP 134->250|2bs2B1|3.8e-17|29.9|107/0|a.1.2.1|1/1|alpha-helical ferredoxin| HM:SCP:REP 262->375|1te4A_|6.4e-13|32.4|108/111|a.118.1.16|1/1|ARM repeat| OP:NHOMO 560 OP:NHOMOORG 546 OP:PATTERN -----------------------1---------1---------11--1-121---------------- 111-------------------------------------------------------------------------------1-----111--111---1-1111111-1---------------11111111111-----32111-11111111111111111111111111111111111111-11---11111111111111111111111111111111111-111111111111111111111111111---11---------111--------1111----11-----------11111111111111111111111-21111111111111-1--111111---1---112----11-1222----1-11111-----11111---1111111111111111-11-11111111-11111111111111-11111111111211111111111111-1------------------------------1111------1111111111111111111111111111-111111111111111--1111111---------11111311------1--1-----1----111111-----------------------------1111111-1111111111111111111111---1111------111111-1111111111-111111111111111111111111111111111111111111111111111--111111111111---1---------11111---------------111111111111111111111111111111----1---1111111111111111111111111------1-111111----------1------------------------------------11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------1------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 206 STR:RPRED 53.4 SQ:SECSTR #############################################################################################################################################ccHHHHHHHHHHHHHHHHHTTcTTcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHTcTTcTTGGGTTEEEGGccEEEEcTTcccHHHHHHHHHHHHHHHGGGcEEEEcccccTTccccEEccTTccEEEcGGGHHHHHHHHHTEETccccccccccccEEEEcTTcccEEGGGEEcccccccHHHHHHHHHHHHHHHTTc####################################### DISOP:02AL 386-387| PSIPRED ccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHccccccccccccHHcccHHHcccccEEEEEEEEccccccccccccccccccEEEEHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHccccccccccccccccccccEEEEEEEEEcccccccccHHcccHHHHHHHHccccccccccEEcHHHHHHHcccccccccHHHHHHcccccccccccEEEccccccccccccHHHccccccccHHHHHHHHccHHHHHHHccccHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccc //