[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhbE
DDBJ      :yhbE         conserved hypothetical protein
Swiss-Prot:YHBE_BACSU   RecName: Full=Uncharacterized protein yhbE;AltName: Full=ORF1;

Homologs  Archaea  1/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->65 2aaaA PDBj 4e-04 19.6 %
:RPS:PDB   103->218 3dtbB PDBj 6e-05 14.2 %
:RPS:PFM   11->101 PF04519 * DUF583 2e-07 34.8 %
:HMM:PFM   5->41 PF04519 * DUF583 0.00053 24.3 37/95  
:HMM:PFM   25->117 PF04519 * DUF583 3e-16 31.1 90/95  
:BLT:SWISS 1->237 YHBE_BACSU e-134 100.0 %
:REPEAT 3|22->55|56->89|107->140

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12723.1 GT:GENE yhbE GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 971374..972087 GB:FROM 971374 GB:TO 972087 GB:DIRECTION + GB:GENE yhbE GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12723.1 GB:DB_XREF InterPro:IPR007607 SubtiList:BG10802 UniProtKB/Swiss-Prot:P39132 GB:GENE:GENE yhbE LENGTH 237 SQ:AASEQ MDVVEKLVINGSGSSKGGTFQSVEINGSGTVAGDVECDTFSFNGNGKADGSVKAKAVTISGSGKIHGDVEAESIRMNGTGFIQGEVSAKQLKIAGSSTFGGTVKADGIDISGKAVMEADCETETFQSEGKCKISGLLNADQVIIKLSAGESYAREIGCRHLQVTCRKGMLTLLRLMPQPVLTAELIEGDVIELTNTKAKTVRGNKVIIGPDCQIETVEYSGDYTCDPSASVETSTKL GT:EXON 1|1-237:0| SW:ID YHBE_BACSU SW:DE RecName: Full=Uncharacterized protein yhbE;AltName: Full=ORF1; SW:GN Name=yhbE; Synonyms=ygaT, yzdA; OrderedLocusNames=BSU08950; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->237|YHBE_BACSU|e-134|100.0|237/237| NREPEAT 1 REPEAT 3|22->55|56->89|107->140| RP:PDB:NREP 2 RP:PDB:REP 8->65|2aaaA|4e-04|19.6|56/476| RP:PDB:REP 103->218|3dtbB|6e-05|14.2|106/612| RP:PFM:NREP 1 RP:PFM:REP 11->101|PF04519|2e-07|34.8|89/94|DUF583| HM:PFM:NREP 2 HM:PFM:REP 5->41|PF04519|0.00053|24.3|37/95|DUF583| HM:PFM:REP 25->117|PF04519|3e-16|31.1|90/95|DUF583| OP:NHOMO 58 OP:NHOMOORG 31 OP:PATTERN ----------------1--------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-222222222-222222--22-2222-22----------122--------------------------------------------------------------------------------------------1------------2------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 68.4 SQ:SECSTR #######EEEcccTT##cccEEEEEccccccTTcEEEEEEEccTTccEEEEEcTTccHHTTccTT#####################################cccTccGGG###EEEccGGGcc##HHHHHHHHHHHcccEEEEccc#cHHHHHHHHHHHH####HHTccEEcTTccccEEEccccGGGEEEEcccHHHHcccccccccccccEEcHH################### DISOP:02AL 1-3, 232-234| PSIPRED ccccccEEEEEEEEEccccEEEEEEEEEEEEEccEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEEEEEEEEcEEEEEEEEEEEEEcEEEEccEEEEEEEEccEEEEEEcccEEEEEEcccEEEEEEEccccEEEEEEEEccEEEEEccEEEEEEccEEEEcccccEEEEEEEEEEEEcccccEEEEEEc //