[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhbF
DDBJ      :yhbF         conserved hypothetical protein
Swiss-Prot:YHBF_BACSU   RecName: Full=Uncharacterized protein yhbF;

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:235 amino acids
:PSIPRED
:HMM:PFM   35->118 PF04519 * DUF583 1.3e-06 17.1 82/95  
:BLT:SWISS 1->235 YHBF_BACSU e-127 100.0 %
:REPEAT 2|26->85|94->153
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12724.2 GT:GENE yhbF GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 972099..972806 GB:FROM 972099 GB:TO 972806 GB:DIRECTION + GB:GENE yhbF GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12724.2 GB:DB_XREF SubtiList:BG10803 UniProtKB/Swiss-Prot:P39133 GB:GENE:GENE yhbF LENGTH 235 SQ:AASEQ METTKLGNLKLYGAGHAAGGAYHNVSIKGEGIVGEGLSAVGCRIYGTGLFLGKAETERLRVLGESECKGDLTAGKINIYGTMKVSGSLQFDRFNLKGQTEIGGNMTGESCDVKGKLSVIGDCETEMFHVTGCVDVSGLLNSGEIKLGLSHDISHVQEIGGTTITVKRRASFFSRKKGKLIADVIEGDRVYLENTEAAVVRGKEVIIGPGCSIGTIEYEYKCECDPHSQIKEKTKL GT:EXON 1|1-235:0| SW:ID YHBF_BACSU SW:DE RecName: Full=Uncharacterized protein yhbF; SW:GN Name=yhbF; Synonyms=yzdB; OrderedLocusNames=BSU08960; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->235|YHBF_BACSU|e-127|100.0|235/235| NREPEAT 1 REPEAT 2|26->85|94->153| SEG 12->23|ygaghaaggayh| HM:PFM:NREP 1 HM:PFM:REP 35->118|PF04519|1.3e-06|17.1|82/95|DUF583| OP:NHOMO 55 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-222222222-222222--22-2222-22----------122--------------------------------------------------------------------------------------------1------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEcccEEEEEEEEEccccEEEEEEEEEEEEEcccEEEEEEEEccEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEcHHHEEEEEEEccEEEEEccccEEEEEEccccccccccEEEEEEEcccEEEEEccEEEEEEccEEEEcccccEEEEEEEEEEEEcccccccEEEEc //