[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhbH
DDBJ      :yhbH         factor involved in shape determination (sporulation)
Swiss-Prot:YHBH_BACSU   RecName: Full=Stress response UPF0229 protein yhbH;

Homologs  Archaea  3/68 : Bacteria  303/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.62.1
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   215->381 1bho1 PDBj 1e-14 12.8 %
:RPS:SCOP  215->381 1bho1  c.62.1.1 * 5e-15 12.8 %
:RPS:PFM   25->383 PF04285 * DUF444 9e-44 34.8 %
:HMM:PFM   7->188 PF04285 * DUF444 5.7e-68 45.0 180/421  
:HMM:PFM   192->384 PF04285 * DUF444 9.8e-97 51.0 192/421  
:BLT:SWISS 1->392 YHBH_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12726.1 GT:GENE yhbH GT:PRODUCT factor involved in shape determination (sporulation) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 975231..976409 GB:FROM 975231 GB:TO 976409 GB:DIRECTION + GB:GENE yhbH GB:PRODUCT factor involved in shape determination (sporulation) GB:FUNCTION 16.13: Shape GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11988534, 12662922, 14523133; Product type f: factor GB:PROTEIN_ID CAB12726.1 GB:DB_XREF GOA:P45742 InterPro:IPR014230 SubtiList:BG11238 UniProtKB/Swiss-Prot:P45742 GB:GENE:GENE yhbH LENGTH 392 SQ:AASEQ MSQNDSGHFLISEENWSLHRKGFDDQQRHQKKVQEAIKNNLPDLVTEESIIMSNGKDVVKIPIRSLDEYKIRYNYDKNKHVGQGDGESQVGDVVARDGSDKKQGPGKGQGAGDQAGEDYYEAEVSLMDLEEALFKELELPNLQQKERDNIIHTDIEFNDIRKTGLTGNIDKKRTMMSAFKRNAMSGKPSFYPIYPEDLKYKTWNDITKPESKAVVLAMMDTSGSMGVWEKYMARSFFFWMTRFLRTKYETVEIEFIAHHTEARVVSEEDFFSKGESGGTICSSVYRKSLELIDEKYNPARYNIYPFHFSDGDNLTSDNARCVKLVNDIMKKANLFCYGEVNQYNRHSTLMSAYKNVKDEKFKYYILKQKSDVFQALKNFFRNEESGVSHQFS GT:EXON 1|1-392:0| SW:ID YHBH_BACSU SW:DE RecName: Full=Stress response UPF0229 protein yhbH; SW:GN Name=yhbH; Synonyms=yzdC; OrderedLocusNames=BSU08980; SW:KW Complete proteome; Stress response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->392|YHBH_BACSU|0.0|100.0|392/392| GO:SWS:NREP 1 GO:SWS GO:0006950|"GO:response to stress"|Stress response| SEG 97->116|dgsdkkqgpgkgqgagdqag| RP:PDB:NREP 1 RP:PDB:REP 215->381|1bho1|1e-14|12.8|164/189| RP:PFM:NREP 1 RP:PFM:REP 25->383|PF04285|9e-44|34.8|351/419|DUF444| HM:PFM:NREP 2 HM:PFM:REP 7->188|PF04285|5.7e-68|45.0|180/421|DUF444| HM:PFM:REP 192->384|PF04285|9.8e-97|51.0|192/421|DUF444| RP:SCP:NREP 1 RP:SCP:REP 215->381|1bho1|5e-15|12.8|164/189|c.62.1.1| OP:NHOMO 311 OP:NHOMOORG 307 OP:PATTERN -------------------------11--1-------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------11111---11----------------------------------------11---11111111111212211111111111111111--------11---------------------------------------------------------------------------------------------11-------1-11-11-111-11--2--1111111---11---------------------1111-------------------1111111111--1---11111111--1----------1----------11-111------------------------------------111111111111-11111111111111111111--11-11---11111----1---11----------11-111------------111-111-1111111---------------------------111111111-1111111111111111111111---1111------11111111111111111-111111111111111111111111---11-1111111111111111----11-1111111-1111---------1111--11--------------------------1111111111111111111----------11111111111111------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 44.1 SQ:SECSTR ################################################################################################################################################################################################################ccccEEEEEEEEccTTccHHHHHHHHHHHHHHHHHTccTTcEEEEEEEccHTTcccHHHHHTTcccccccccHHHHHHHHHHHTTcGGGTccTTccEEEEEEEccccccccccGGGTHHHHHHTTEEEEEEcTTcccTTTHHHHHHHccccHHHHEEEEEEEcccTTGGGcHH########### DISOP:02AL 1-6, 8-10, 48-58, 75-117, 382-392| PSIPRED ccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEcccccEEEEccccccccEEEEccccccccccccccEEccccccccccccccccccccccccccccEEEEEEEcHHHHHHHHHHHHccccccccccccccEEEEEEccEEEEccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccccccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccccccHHHcccccccccccHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHHHHHHHcEEEEEEEEccccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHcccccccccccc //