[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhbI
DDBJ      :yhbI         putative transcriptional regulator (MarR family)
Swiss-Prot:YHBI_BACSU   RecName: Full=Uncharacterized HTH-type transcriptional regulator yhbI;

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->136 1jgsA PDBj 3e-09 33.1 %
:RPS:PDB   13->143 3bddA PDBj 3e-15 17.6 %
:RPS:SCOP  27->144 2fbiA1  a.4.5.28 * 3e-15 21.2 %
:HMM:SCOP  12->155 1lj9A_ a.4.5.28 * 7.4e-23 27.8 %
:HMM:PFM   38->96 PF01047 * MarR 9.7e-20 37.3 59/59  
:HMM:PFM   89->118 PF11458 * Mistic 0.00014 39.3 28/84  
:BLT:SWISS 1->154 YHBI_BACSU 4e-83 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12727.1 GT:GENE yhbI GT:PRODUCT putative transcriptional regulator (MarR family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 976569..977033 GB:FROM 976569 GB:TO 977033 GB:DIRECTION + GB:GENE yhbI GB:PRODUCT putative transcriptional regulator (MarR family) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr: putative regulator GB:PROTEIN_ID CAB12727.1 GB:DB_XREF GOA:O31592 InterPro:IPR011991 SubtiList:BG13003 UniProtKB/Swiss-Prot:O31592 GB:GENE:GENE yhbI LENGTH 154 SQ:AASEQ MTESERALLTFEQLFDTSRAIYKKQKKILEIVLEPFDITVLQYLLMFKIHQSGSTPLSKLAMSLDLKPASVTRMTDILYKRQLMNRYDSPDDRRIVMIQLTEEGEELIEKAAVQYAKMGAGLYQKLDTSQLQYLRKLAGSLTKLAEGCSEKSGN GT:EXON 1|1-154:0| SW:ID YHBI_BACSU SW:DE RecName: Full=Uncharacterized HTH-type transcriptional regulator yhbI; SW:GN Name=yhbI; OrderedLocusNames=BSU08990; SW:KW Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->154|YHBI_BACSU|4e-83|100.0|154/154| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 11->136|1jgsA|3e-09|33.1|121/138| RP:PDB:NREP 1 RP:PDB:REP 13->143|3bddA|3e-15|17.6|131/138| HM:PFM:NREP 2 HM:PFM:REP 38->96|PF01047|9.7e-20|37.3|59/59|MarR| HM:PFM:REP 89->118|PF11458|0.00014|39.3|28/84|Mistic| RP:SCP:NREP 1 RP:SCP:REP 27->144|2fbiA1|3e-15|21.2|118/136|a.4.5.28| HM:SCP:REP 12->155|1lj9A_|7.4e-23|27.8|144/144|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 23 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------111111-1111-1--------111--1------------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 98.1 SQ:SECSTR ccccccHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEccccTTcEEEEEcHHHHHHHTTcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHTTc### DISOP:02AL 1-4, 145-154| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccc //