[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhbJ
DDBJ      :yhbJ         putative integral inner membrane protein; putative exporter subunit
Swiss-Prot:YHBJ_BACSU   RecName: Full=Putative efflux system component yhbJ;

Homologs  Archaea  0/68 : Bacteria  264/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.84.1f.46.1
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   46->118 1o78A PDBj 6e-05 37.5 %
:RPS:PDB   47->122 3bg5D PDBj 1e-10 21.1 %
:RPS:PDB   96->142 2ejmA PDBj 7e-06 29.8 %
:RPS:SCOP  51->123 1dczA  b.84.1.1 * 1e-08 31.5 %
:RPS:SCOP  100->219 1t5eA  f.46.1.1 * 1e-09 17.2 %
:HMM:SCOP  43->124 1o78A_ b.84.1.1 * 1.2e-08 25.6 %
:RPS:PFM   41->141 PF00529 * HlyD 7e-07 29.0 %
:HMM:PFM   96->204 PF00529 * HlyD 1.3e-15 24.8 109/306  
:HMM:PFM   60->122 PF00364 * Biotin_lipoyl 2.9e-10 25.4 63/74  
:HMM:PFM   22->61 PF03748 * FliL 0.0002 22.9 35/149  
:BLT:SWISS 1->221 YHBJ_BACSU 2e-93 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12728.1 GT:GENE yhbJ GT:PRODUCT putative integral inner membrane protein; putative exporter subunit GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 977069..977734 GB:FROM 977069 GB:TO 977734 GB:DIRECTION + GB:GENE yhbJ GB:PRODUCT putative integral inner membrane protein; putative exporter subunit GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB12728.1 GB:DB_XREF GOA:O31593 HSSP:1O78 InterPro:IPR006143 SubtiList:BG13004 UniProtKB/Swiss-Prot:O31593 GB:GENE:GENE yhbJ LENGTH 221 SQ:AASEQ MIEDETKGENKMNRGRLILTNIIGLIVVLAIIAGGAYYYYQSTNYVKTDEAKVAGDMAAITAPAAGKVSDWDLDEGKTVKKGDTVAKIKGEQTVDVKSIMDGTIVKNEVKNGQTVQAGTTIAQTIDMDNLYITANIKETDIADIEVGNSVDVVVDGDPDTTFDGTVEEIGYATNSTFDMLPSTNSSGNYTKVTQKVPVKISIKNPSDKVLPGMNASVKISE GT:EXON 1|1-221:0| SW:ID YHBJ_BACSU SW:DE RecName: Full=Putative efflux system component yhbJ; SW:GN Name=yhbJ; OrderedLocusNames=BSU09000; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->221|YHBJ_BACSU|2e-93|100.0|221/221| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 16->36| SEG 22->40|iiglivvlaiiaggayyyy| SEG 143->166|dievgnsvdvvvdgdpdttfdgtv| BL:PDB:NREP 1 BL:PDB:REP 46->118|1o78A|6e-05|37.5|72/84| RP:PDB:NREP 2 RP:PDB:REP 47->122|3bg5D|1e-10|21.1|76/1067| RP:PDB:REP 96->142|2ejmA|7e-06|29.8|47/99| RP:PFM:NREP 1 RP:PFM:REP 41->141|PF00529|7e-07|29.0|100/259|HlyD| HM:PFM:NREP 3 HM:PFM:REP 96->204|PF00529|1.3e-15|24.8|109/306|HlyD| HM:PFM:REP 60->122|PF00364|2.9e-10|25.4|63/74|Biotin_lipoyl| HM:PFM:REP 22->61|PF03748|0.0002|22.9|35/149|FliL| GO:PFM:NREP 3 GO:PFM GO:0008565|"GO:protein transporter activity"|PF00529|IPR006143| GO:PFM GO:0009306|"GO:protein secretion"|PF00529|IPR006143| GO:PFM GO:0016020|"GO:membrane"|PF00529|IPR006143| RP:SCP:NREP 2 RP:SCP:REP 51->123|1dczA|1e-08|31.5|73/77|b.84.1.1| RP:SCP:REP 100->219|1t5eA|1e-09|17.2|116/231|f.46.1.1| HM:SCP:REP 43->124|1o78A_|1.2e-08|25.6|82/0|b.84.1.1|1/1|Single hybrid motif| OP:NHOMO 329 OP:NHOMOORG 264 OP:PATTERN -------------------------------------------------------------------- 111-------------------------------------------------------------------------------------222--1-------11--4-1-1---------------11111-111-----------------------------------1---------------------2-1111111111111111--2211111111--1-------1-11111111111111111111--------------------------------------------------------------------------2------------11------------1-11111---11-------11-111-11111-33221-1---11-1-1-1-1--2-1111122213--311143233332-1------1111---------------11-1------------1111111111111-----1211------1332211----1112------211---1----1-----1------------1-----------------------1---1-1-11-13-1-----------------------------------111-1------11111-11111-21-1-111-------------111--1-----111--------11----1-------121----1----------------1----11----------------------------1--11---------------11111-1-----222213311212--111111111111--1-1-----111-11112122111------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 46.2 SQ:SECSTR ########################################TEEEccccccccccccccEEEcccccEEEEEcccccEEccTTcccEEEEcccEEEEccccccEEcEEcccTTccccTTcEEEEHHHHHHHHHHTcccTTEEE############################################################################### PSIPRED ccccccccccccccccEEccccccEEEEEEHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccEEEEEEEEccccEEccccEEEEEEEcccEEEEEEEcHHHHHHcccccEEEEEEEcccccEEEEEEEEEEccccccccccccccccccEEEEEEEEEEEEEEEccccccccccEEEEEEEc //