[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcB
DDBJ      :yhcB         putative oxidoreductase associated to oxygen stress
Swiss-Prot:YHCB_BACSU   RecName: Full=Uncharacterized protein yhcB;

Homologs  Archaea  21/68 : Bacteria  337/915 : Eukaryota  65/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->166 2rg1A PDBj 2e-20 38.4 %
:RPS:PDB   2->174 3b6iA PDBj 3e-27 35.5 %
:RPS:SCOP  2->176 2arkA1  c.23.5.8 * 1e-39 33.7 %
:HMM:SCOP  1->174 2a5lA1 c.23.5.8 * 2.4e-40 41.6 %
:RPS:PFM   2->120 PF03358 * FMN_red 4e-18 47.5 %
:HMM:PFM   2->121 PF03358 * FMN_red 1.1e-14 34.2 114/146  
:BLT:SWISS 1->176 YHCB_BACSU e-102 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12730.1 GT:GENE yhcB GT:PRODUCT putative oxidoreductase associated to oxygen stress GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 979396..979926 GB:FROM 979396 GB:TO 979926 GB:DIRECTION + GB:GENE yhcB GB:PRODUCT putative oxidoreductase associated to oxygen stress GB:FUNCTION 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15754243; Product type pe : putative enzyme GB:PROTEIN_ID CAB12730.1 GB:DB_XREF GOA:P54586 InterPro:IPR008254 SubtiList:BG11580 UniProtKB/Swiss-Prot:P54586 GB:GENE:GENE yhcB LENGTH 176 SQ:AASEQ MKIYVVYDSEGEHTKVLAEAIAEGARENDAAEVFIDHVDQADIRKLKDMDAIIWGCPGHFGTISSGLKTWIDRLGYLWAEGELINKVGAVFCTTATTHGGLEMTMHNLITPMFHQGMIVVGLPGNVPENALYGSYYGAGVTCPVDSDELMSEEGIQLGRALGRRVSQVTGNLTAGQ GT:EXON 1|1-176:0| SW:ID YHCB_BACSU SW:DE RecName: Full=Uncharacterized protein yhcB; SW:GN Name=yhcB; OrderedLocusNames=BSU09020; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->176|YHCB_BACSU|e-102|100.0|176/176| BL:PDB:NREP 1 BL:PDB:REP 2->166|2rg1A|2e-20|38.4|151/168| RP:PDB:NREP 1 RP:PDB:REP 2->174|3b6iA|3e-27|35.5|172/197| RP:PFM:NREP 1 RP:PFM:REP 2->120|PF03358|4e-18|47.5|118/149|FMN_red| HM:PFM:NREP 1 HM:PFM:REP 2->121|PF03358|1.1e-14|34.2|114/146|FMN_red| RP:SCP:NREP 1 RP:SCP:REP 2->176|2arkA1|1e-39|33.7|166/184|c.23.5.8| HM:SCP:REP 1->174|2a5lA1|2.4e-40|41.6|173/0|c.23.5.8|1/1|Flavoproteins| OP:NHOMO 559 OP:NHOMOORG 423 OP:PATTERN ------1-11111111-------1-----------11-1111---1--1-111--------------- -11-2----------11-------11-----11-----------1---------------111---2--1------------11-1-----------------1-1------------------------------11111-------------------------------------------11---1-1-1---------------112221---1---11--------2------------------------------------------------------------------------------------------------------1-1-1--------1---------11---1----------112111-----21111-111111111111111111-111112111-1-111---111-3311--1--1111-11---------111---1---------------------------------1-1-----233333111112222111111321123212223-21-1--111--1-121121--------1-221---1-11--1------1-1111--------21-------------------------22--1121-111------1----------------2222------1111-1-1-11111111-1111112111111111111111-111-11111111111111111--11111--111111111111---211111111111122---------------212211111-21112111111111131111111121111---111111121111111111-112111------------------------------------------------2-------11- ------------113---1-111---1------1--1-------------1111--1-----442-211133314211211212121--32--23-222--11445-1-3-----------------------------------------------------------------142-----12---3-2-1-6283- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcccccHHHHHHHHHHHHHHTcTTcEEEEEEcccccGGGGGGccEEEEEEEEETTEEcHHHHHHHTTcHHHHHHTTTTTcEEEEEEEEccccTTHHHHHHHHHHHHHHTTcEEcccTTccGcccccccTTccEEEccTTccccccHHHHHHHHHHHHHHHHHHHHHHccc DISOP:02AL 143-152| PSIPRED cEEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHccEEEEEcccccccccHHHHHHHHHHccHHHcccccccEEEEEEccccccccHHHHHHHHHHHHHHcccEEEccccccHHHHcccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccc //