[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcC
DDBJ      :yhcC         hypothetical protein
Swiss-Prot:YHCC_BACSU   RecName: Full=Uncharacterized protein yhcC;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->96 PF12273 * RCR 2.3e-06 20.7 87/130  
:BLT:SWISS 17->124 YHCC_BACSU 3e-52 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12731.1 GT:GENE yhcC GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 979939..980313 GB:FROM 979939 GB:TO 980313 GB:DIRECTION + GB:GENE yhcC GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12731.1 GB:DB_XREF GOA:P54587 SubtiList:BG11581 UniProtKB/Swiss-Prot:P54587 GB:GENE:GENE yhcC LENGTH 124 SQ:AASEQ MAIIIAIIAAVIVIAALITFNVRNASPGPEKQEATDRIAPPEEEKNEAHYPAEARAAEHTPSVVKNDSPKEKRDTMGDDIYRQALQKFKHSDEVHAEEEVTEESDKMQDRSYRDALLSMKNKKK GT:EXON 1|1-124:0| SW:ID YHCC_BACSU SW:DE RecName: Full=Uncharacterized protein yhcC; SW:GN Name=yhcC; OrderedLocusNames=BSU09030; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 17->124|YHCC_BACSU|3e-52|100.0|108/124| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 2->24| SEG 2->16|aiiiaiiaaviviaa| SEG 93->103|evhaeeevtee| HM:PFM:NREP 1 HM:PFM:REP 2->96|PF12273|2.3e-06|20.7|87/130|RCR| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-50, 60-75, 95-110, 121-124| PSIPRED cHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccccccHHHHHHHcccHHHcccccHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //