[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcD
DDBJ      :yhcD         hypothetical protein
Swiss-Prot:YHCD_BACSU   RecName: Full=Uncharacterized protein yhcD;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->51 YHCD_BACSU 8e-27 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12732.1 GT:GENE yhcD GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 980313..980468 GB:FROM 980313 GB:TO 980468 GB:DIRECTION + GB:GENE yhcD GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12732.1 GB:DB_XREF SubtiList:BG11582 UniProtKB/Swiss-Prot:P54588 GB:GENE:GENE yhcD LENGTH 51 SQ:AASEQ MKKANPFTHAGLPFLLFPSIMFLSNKSMEYVVFHLDLVYYVTHTPRIFSGR GT:EXON 1|1-51:0| SW:ID YHCD_BACSU SW:DE RecName: Full=Uncharacterized protein yhcD; SW:GN Name=yhcD; OrderedLocusNames=BSU09040; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->51|YHCD_BACSU|8e-27|100.0|51/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 50-51| PSIPRED cccccccccccccHHHHHHHHHHcccccEEEEEEEEEEEEEEcccEEEccc //