[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcE
DDBJ      :yhcE         putative integral inner membrane orphan protein
Swiss-Prot:YHCE_BACSU   RecName: Full=Uncharacterized protein yhcE;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:253 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->77 PF00335 * Tetraspannin 0.00014 25.0 64/221  
:BLT:SWISS 1->253 YHCE_BACSU e-133 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12733.1 GT:GENE yhcE GT:PRODUCT putative integral inner membrane orphan protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 980473..981234 GB:FROM 980473 GB:TO 981234 GB:DIRECTION + GB:GENE yhcE GB:PRODUCT putative integral inner membrane orphan protein GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406; Product type pm: putative membrane component GB:PROTEIN_ID CAB12733.1 GB:DB_XREF GOA:P54589 SubtiList:BG11583 UniProtKB/Swiss-Prot:P54589 GB:GENE:GENE yhcE LENGTH 253 SQ:AASEQ MNSFLGLLKKDIKLSRMWLLVWICGIIFLLGTGHIIASRTKEPLVIFGFFVAVAFFLLFLSPVFVFYHLRKEGKSQLWLYNPNGGLWLFSSKLAASLLYQFVIQLALTAYGIWMYHMLSVKNLLEHQVDITSTVALLNMYGLISSLDMSVTVIVFWTVFHSLRNWRGMRWAAMVLLVAMWLFFDEYIISPLVESQKHFWPVTVYCNFDFHFHNVWRLELKPIHLSVLGFPIAIVITFLLLIMASKLLDRKVEV GT:EXON 1|1-253:0| SW:ID YHCE_BACSU SW:DE RecName: Full=Uncharacterized protein yhcE; SW:GN Name=yhcE; OrderedLocusNames=BSU09050; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->253|YHCE_BACSU|e-133|100.0|253/253| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 12->34| TM:REGION 45->67| TM:REGION 93->115| TM:REGION 133->155| TM:REGION 170->192| TM:REGION 224->246| SEG 44->66|lvifgffvavaffllflspvfvf| HM:PFM:NREP 1 HM:PFM:REP 14->77|PF00335|0.00014|25.0|64/221|Tetraspannin| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 252-253| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //