[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcF
DDBJ      :yhcF         putative transcriptional regulator (GntR family)
Swiss-Prot:YHCF_BACSU   RecName: Full=Uncharacterized HTH-type transcriptional regulator yhcF;

Homologs  Archaea  9/68 : Bacteria  286/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->101 3by6E PDBj 2e-14 35.5 %
:RPS:PDB   4->112 3by6A PDBj 4e-18 31.2 %
:RPS:SCOP  9->79 1e2xA1  a.4.5.6 * 9e-16 19.7 %
:HMM:SCOP  3->92 1v4rA1 a.4.5.6 * 1.6e-16 37.1 %
:RPS:PFM   14->74 PF00392 * GntR 4e-07 41.0 %
:HMM:PFM   12->74 PF00392 * GntR 3.1e-16 39.7 63/64  
:HMM:PFM   76->115 PF04803 * Cor1 0.00034 27.5 40/130  
:BLT:SWISS 1->121 YHCF_BACSU 3e-65 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12734.1 GT:GENE yhcF GT:PRODUCT putative transcriptional regulator (GntR family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 981237..981602 GB:FROM 981237 GB:TO 981602 GB:DIRECTION + GB:GENE yhcF GB:PRODUCT putative transcriptional regulator (GntR family) GB:FUNCTION 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr: putative regulator GB:PROTEIN_ID CAB12734.1 GB:DB_XREF GOA:P54590 InterPro:IPR011991 SubtiList:BG11584 UniProtKB/Swiss-Prot:P54590 GB:GENE:GENE yhcF LENGTH 121 SQ:AASEQ MDNQFQSSKPIYLQIADQIFYRLVRKELLPGDKLPSVREMAIQTKVNPNTIQRTYSEMERLGIVETRRGQGTFIAEKAEIVDELKDKLTREVLEGFVKQMKELGLTKEEMLEGIKTFTEGG GT:EXON 1|1-121:0| SW:ID YHCF_BACSU SW:DE RecName: Full=Uncharacterized HTH-type transcriptional regulator yhcF; SW:GN Name=yhcF; OrderedLocusNames=BSU09060; SW:KW Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->121|YHCF_BACSU|3e-65|100.0|121/121| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 9->101|3by6E|2e-14|35.5|93/124| RP:PDB:NREP 1 RP:PDB:REP 4->112|3by6A|4e-18|31.2|109/119| RP:PFM:NREP 1 RP:PFM:REP 14->74|PF00392|4e-07|41.0|61/64|GntR| HM:PFM:NREP 2 HM:PFM:REP 12->74|PF00392|3.1e-16|39.7|63/64|GntR| HM:PFM:REP 76->115|PF04803|0.00034|27.5|40/130|Cor1| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 1 RP:SCP:REP 9->79|1e2xA1|9e-16|19.7|71/73|a.4.5.6| HM:SCP:REP 3->92|1v4rA1|1.6e-16|37.1|89/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 528 OP:NHOMOORG 295 OP:PATTERN -------11111111------------------------------1---------------------- 112-1--------1---11-11----11111-21111223-1-1-1---11-----1-------2--143111111111-621-----111--111---------2-1-1----------------------------------2-1--1--1-111-----1------1---1---------1----11-21255555445454643545332245421243214444342311111111111111121111212222211114411221131111--1111111-11111111111111111111111111-1111111113412355544443443544322273131-53--44121413-2---1---1-2-------------------------------------------1---------------------------------------------------------------------------1--1----------------------------1----1---------------------------------------------1--1-----------------------------------------------------11----1111111----111111-1---------------------------------------------------------------------------------------------------2---1------------------------------------1----111-----1-----------------2-----11---1111111111----------------------1---------------------------11111--1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 97.5 SQ:SECSTR HcccccccccHHHHHHHHHHHHHHTTcccTTcEEccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHTTTc### DISOP:02AL 1-7, 79-90| PSIPRED ccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcc //