[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcH
DDBJ      :yhcH         putative ABC transporter (ATP-binding protein)
Swiss-Prot:YHCH_BACSU   RecName: Full=Uncharacterized ABC transporter ATP-binding protein yhcH;

Homologs  Archaea  68/68 : Bacteria  910/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:305 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   7->224 1vplA PDBj 2e-33 35.5 %
:RPS:PDB   3->235 2dwoA PDBj 7e-40 8.8 %
:RPS:SCOP  3->209 1sgwA  c.37.1.12 * 6e-44 24.7 %
:HMM:SCOP  7->212 1ii8.1 c.37.1.12 * 5.6e-62 32.0 %
:RPS:PFM   44->161 PF00005 * ABC_tran 3e-14 37.1 %
:HMM:PFM   44->161 PF00005 * ABC_tran 2.5e-22 34.8 115/118  
:HMM:PFM   13->61 PF03193 * DUF258 0.00025 18.8 48/161  
:BLT:SWISS 1->305 YHCH_BACSU e-172 100.0 %
:PROS 133->147|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12736.1 GT:GENE yhcH GT:PRODUCT putative ABC transporter (ATP-binding protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 982319..983236 GB:FROM 982319 GB:TO 983236 GB:DIRECTION + GB:GENE yhcH GB:PRODUCT putative ABC transporter (ATP-binding protein) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15870467, 7476193; Product type pt: putative transporter GB:PROTEIN_ID CAB12736.1 GB:DB_XREF GOA:P54592 InterPro:IPR003593 SubtiList:BG11586 UniProtKB/Swiss-Prot:P54592 GB:GENE:GENE yhcH LENGTH 305 SQ:AASEQ MKTVLELKNVTKNIRGRTIIDDLSFTIREGEVFGFLGPNGAGKTTTIRMMVGLMKLSKGDVLICGQSITKEYAKAIKHIGAIVENPELYKFLSGYKNLQQFARMVKGVTKEKIDEVVELVGLTDRIHDKVKTYSLGMRQRLGLAQCLLHDPKVLILDEPTNGLDPAGIREIRDHLKKLTRERGMAVIVSSHLLSEMELMCDRIAILQKGKLIDIQNVKDENIDENDTYFFQVEQPSEAATVLNQYDLLSKTNGVEIKLAKEEVPAVIELLVMQQIRIYEVKVITKSLEDRFLEMTGETKEEVQHA GT:EXON 1|1-305:0| SW:ID YHCH_BACSU SW:DE RecName: Full=Uncharacterized ABC transporter ATP-binding protein yhcH; SW:GN Name=yhcH; OrderedLocusNames=BSU09080; SW:KW ATP-binding; Complete proteome; Nucleotide-binding; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->305|YHCH_BACSU|e-172|100.0|305/305| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 133->147|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 7->224|1vplA|2e-33|35.5|217/238| RP:PDB:NREP 1 RP:PDB:REP 3->235|2dwoA|7e-40|8.8|217/449| RP:PFM:NREP 1 RP:PFM:REP 44->161|PF00005|3e-14|37.1|116/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 44->161|PF00005|2.5e-22|34.8|115/118|ABC_tran| HM:PFM:REP 13->61|PF03193|0.00025|18.8|48/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 3->209|1sgwA|6e-44|24.7|198/200|c.37.1.12| HM:SCP:REP 7->212|1ii8.1|5.6e-62|32.0|203/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 52920 OP:NHOMOORG 1176 OP:PATTERN XWOBUQJOcbbXZWZUmKSUNOOdwPSfmXgTLDEEFDIIIGEXbTYoMR**n9SiRXZPTMNHa1AB UZzN*dehqqsYcVcUWQP-PlCCa*QQQQQOwspt****T*b*t*vlrhdP***OSgHHy**j*w****eaddd*edfQ*jjCBBADaZZT7SGLM11HIZOPPiRdQW9999A99CCDCCCCLWSKTbQLUVbSntt**KKK*g*lxyhhnciUWNJRLOIjmbo***eLVKRKHLUIRJLkbbSO*mBXj*************************ls***oy********cstuuurrssssssrijeig*lfc**ePhZl**TU**faTemjmmouuz*zr****x*xywrx*vxyjjjiikilnjhjj*rtmlnusvvw***********o*o****goom*ul*z*ruUJ**zmbgksVdmftsQZdaNhWWWMKPOORia***aUx****************-ru*mj*r***TD**************KKL**********VUVVVVVVwdfLUkb*887688886678CAGHACFBBBBBB97B6LDFKBH***************y********q********DS**r*ouqv******frkPXLQmbKONLNMLWSTbqqf**WfWzrXmyaXlLkghWWZmUcaaWcw*b*OLQVGOOOPNJBCDDEEFDDHTIGORQwuuRrXiMZO*SYZbXQYeaXYXYahaage5-GMYQP221322****b************-*****************z******pslttqsststusqrtrsq*xsszzy*S6************33NLGJFGISSSSSN*p*ggfbcaMPTQNXRUjNPQOPHYHNVrgxwyvz***y****n***IFFDFHGFFNisq*vwwww*****VWTNPOOPRQIGHHA7NWWWOOOO9989988A*DcC9A9G-DEHAMJCMNLBJNCJC99BeqzYVp*twnFhO 2244spN-ZI7FZkUHFEGIKNNTHXMGHCEBENIKCIGFGGGBDDJJIMNMZOHHK9ECDD99G4884BB5BCE7A2488DCADH58-EPAFDBD9999B7CPIJ9SjmlYYaffeKKHDITLnqB*G**j4lSoMJKDeILlZFMGGFYED*GXROwJb*IlOiE*dh*XdiPGNLN*IHIFU*ei*G*wMM*w**M ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 296-305| PSIPRED cccEEEEEccEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHccEEEccccccccccHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHEEEEEccEEEEEccHHHHHHHHccEEEEEEEcHHHHHHHHHHccEEEcccEEEEEEccccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHccHHHHHccc //