[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcI
DDBJ      :yhcI         putative ABC transporter (permease)
Swiss-Prot:YHCI_BACSU   RecName: Full=Uncharacterized protein yhcI;

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:313 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->77 PF01724 * DUF29 9.5e-05 26.3 38/139  
:HMM:PFM   99->151 PF03653 * UPF0093 7.9e-05 22.6 53/147  
:BLT:SWISS 1->313 YHCI_BACSU e-138 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12737.1 GT:GENE yhcI GT:PRODUCT putative ABC transporter (permease) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 983229..984170 GB:FROM 983229 GB:TO 984170 GB:DIRECTION + GB:GENE yhcI GB:PRODUCT putative ABC transporter (permease) GB:FUNCTION 16.1: Circulate 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 15870467, 16850406; Product type pt: putative transporter GB:PROTEIN_ID CAB12737.1 GB:DB_XREF GOA:P54593 SubtiList:BG11587 UniProtKB/Swiss-Prot:P54593 GB:GENE:GENE yhcI LENGTH 313 SQ:AASEQ MLNLIYNEWLKIFSRAGTWVMIGILGLTMVGFAFLANHFSAGESNSHWKQELQAQNAELKKEIKEDPSLKDGYKETITLNDYRIEHNIPSDTGYTVWSYVTDSANFTILTGLFTIIIAAGIVANEFNWGTIKLLMIRPLSRFQILMSKYITVLLFGLLLLLILFIGSTLLGLIFFGTGGETAANIHLIYKDGHVIEQNMMGHLATTYLSESVSALMVATMAFMLSAVFRNSSLAVGFSIFLLVAGTTATAFIAAKFDWAKYILFANVDLTQYVDGTPLIKGMTMTFSLVMLAIYFIIFLLLAFGIFMKRDIAN GT:EXON 1|1-313:0| SW:ID YHCI_BACSU SW:DE RecName: Full=Uncharacterized protein yhcI; SW:GN Name=yhcI; OrderedLocusNames=BSU09090; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->313|YHCI_BACSU|e-138|100.0|313/313| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 18->40| TM:REGION 110->132| TM:REGION 151->173| TM:REGION 208->230| TM:REGION 240->262| TM:REGION 284->306| SEG 106->117|ftiltglftiii| SEG 150->181|itvllfglllllilfigstllgliffgtgget| SEG 291->306|laiyfiiflllafgif| HM:PFM:NREP 2 HM:PFM:REP 40->77|PF01724|9.5e-05|26.3|38/139|DUF29| HM:PFM:REP 99->151|PF03653|7.9e-05|22.6|53/147|UPF0093| OP:NHOMO 27 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----111-111111--22211111--11---------2-----------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 41-47, 49-51, 57-74| PSIPRED cccHHHHHHHHHHHHccEEEEHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccHHHEEEEEccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccc //