[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcJ
DDBJ      :yhcJ         putative ABC transporter (binding lipoprotein)
Swiss-Prot:YHCJ_BACSU   RecName: Full=Uncharacterized lipoprotein yhcJ;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  536/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:276 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   29->262 1p99A PDBj 2e-29 30.8 %
:RPS:PDB   24->207 1b1xA PDBj 1e-12 10.9 %
:RPS:SCOP  29->267 1p99A  c.94.1.1 * 2e-65 31.4 %
:HMM:SCOP  28->275 1p99A_ c.94.1.1 * 3.9e-57 36.7 %
:RPS:PFM   29->260 PF03180 * Lipoprotein_9 5e-44 38.1 %
:HMM:PFM   29->261 PF03180 * Lipoprotein_9 1.5e-74 36.5 233/237  
:BLT:SWISS 1->276 YHCJ_BACSU e-157 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12739.2 GT:GENE yhcJ GT:PRODUCT putative ABC transporter (binding lipoprotein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 984901..985731 GB:FROM 984901 GB:TO 985731 GB:DIRECTION + GB:GENE yhcJ GB:PRODUCT putative ABC transporter (binding lipoprotein) GB:FUNCTION 7: Transport and binding proteins GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type lp: lipoprotein GB:PROTEIN_ID CAB12739.2 GB:DB_XREF GOA:P54594 InterPro:IPR004872 SubtiList:BG11588 UniProtKB/Swiss-Prot:P54594 GB:GENE:GENE yhcJ LENGTH 276 SQ:AASEQ MKKWLICSFVLVLLVSFTACSPSAEHESIKIGIAESDGAIWNYIAQKAEEAGLDIQLIPFSDYAESDIALANKEIDANAFQTISYFQSFTEKYKLNLAPLGTTYITPMGIYSKRYERIRDISRGAVVSVPDKAFDFGRALTVLQEAGLLTLKNGFNGTGSVDMIKDNPRHLKLKAVRQQDAVSGADVFVMKPSEAKKAGLNPKKHTLKSGGLMSEEEMNLIVVRAEDQDREALQTILELYQADDTAAFIEKEYQGDLVPAFLPLKRLSDWKNEFEH GT:EXON 1|1-276:0| SW:ID YHCJ_BACSU SW:DE RecName: Full=Uncharacterized lipoprotein yhcJ;Flags: Precursor; SW:GN Name=yhcJ; OrderedLocusNames=BSU09110; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->276|YHCJ_BACSU|e-157|100.0|276/276| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| TM:NTM 1 TM:REGION 4->26| BL:PDB:NREP 1 BL:PDB:REP 29->262|1p99A|2e-29|30.8|234/255| RP:PDB:NREP 1 RP:PDB:REP 24->207|1b1xA|1e-12|10.9|184/689| RP:PFM:NREP 1 RP:PFM:REP 29->260|PF03180|5e-44|38.1|231/236|Lipoprotein_9| HM:PFM:NREP 1 HM:PFM:REP 29->261|PF03180|1.5e-74|36.5|233/237|Lipoprotein_9| RP:SCP:NREP 1 RP:SCP:REP 29->267|1p99A|2e-65|31.4|239/257|c.94.1.1| HM:SCP:REP 28->275|1p99A_|3.9e-57|36.7|248/255|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 1045 OP:NHOMOORG 539 OP:PATTERN -------------------------------------------------------------------- -----2211111111----------1----------111-----121211111-1111-----111121111222111-121-------------------1---------------11111111----------------------------------------------------------1-2------12444444442444444313312344112244322222223322222222222222322223212232311132334412123244433341111111111111111111111111111111-12221111-2112333332312--2221---111211----11-1-11-1-11-1-11---111-111-11-125---322-222222222213---2--2-1-1--21121111111132-----11411---11111111-11---13-----------------------------------343435455552444255434444235484244--222--2228-113--------111111111--------------1-------------------1----2211444441121111111-1-----221-1-----1--------------------------------43431422222222222-2222222222222222221454441142222222222222222422211121-322222222222--1-111111111---1-22211111111211144444321111-33333543234341333111111111-1111111111211111111111111111---4---------------11---------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------3-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 92.0 SQ:SECSTR ######################ccccccEEEEEccHHHHHHHHHHHHHHTTcccEEEEEcccHHHHHHHHHTTccccEEEcHHHHHHHHcTTTcEEEcccccEEEEEEEEETTccccGGGcTTcEEEccTTcTTTTHHHHHHcHHHHccccTTccHHHHHHHHccEEEcTTccTTTGTTTccccTTTTTcccTTcTTcHHHHHHHHHTcccTTcTTcHHHHHHHHHHTTcccEEEEETTHHHHHcccHHHHTcEEcGGGGHHHHHHHHHHccHHHH PSIPRED ccHHHHHHHHHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHcccEEEEEEccHHHHHHHHHHccccEEEEEEEEEEEEEEEccccccHHHcccccEEEEccccccHHHHHHHHHHcccEEEcccccccccHHHHHHccccccccccccccccccccEEEEccHHHHHccccccHHEEEccccccccEEEEEEEcHHHcccHHHHHHHHHHccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHcc //