[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcK
DDBJ      :yhcK         putative diguanylate cyclase or phosphodiesterase
Swiss-Prot:YHCK_BACSU   RecName: Full=Uncharacterized protein yhcK;

Homologs  Archaea  0/68 : Bacteria  659/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.58.29
:359 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   195->352 1w25A PDBj 9e-29 44.6 %
:RPS:PDB   124->357 3breB PDBj 3e-36 29.8 %
:RPS:SCOP  197->354 1w25A3  d.58.29.2 * 2e-38 41.4 %
:HMM:SCOP  197->358 1w25A3 d.58.29.2 * 2e-55 46.0 %
:RPS:PFM   41->78 PF07694 * 5TM-5TMR_LYT 2e-04 44.7 %
:RPS:PFM   192->350 PF00990 * GGDEF 2e-34 46.5 %
:HMM:PFM   192->351 PF00990 * GGDEF 1.1e-53 44.0 159/161  
:HMM:PFM   35->117 PF07694 * 5TM-5TMR_LYT 6.3e-18 25.3 83/88  
:BLT:SWISS 1->359 YHCK_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12740.1 GT:GENE yhcK GT:PRODUCT putative diguanylate cyclase or phosphodiesterase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(985734..986813) GB:FROM 985734 GB:TO 986813 GB:DIRECTION - GB:GENE yhcK GB:PRODUCT putative diguanylate cyclase or phosphodiesterase GB:FUNCTION 16.8: Protect 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12740.1 GB:DB_XREF GOA:P54595 InterPro:IPR011620 SubtiList:BG11589 UniProtKB/Swiss-Prot:P54595 GB:GENE:GENE yhcK LENGTH 359 SQ:AASEQ MLKELFVNLTILITFNYLFTHLFKERLVHKKDSISFQAVKGLACGLLGVILMVFGFTYQHSIIDLRNIPIMIAALYGGWVSTATALAMITAGRLLITMNTSALYSVIIICIAAIPSLIVSRRKKVQLKHAFYLLIITNSLISFSFYFLIDLHSYELHLYFWIISIAGGMLSLYIIDHETNAHLLFKQYKFQAHFDFLTGVYNRRKFEETTKALYQQAADTPHFQFALIYMDIDHFKTINDQYGHHEGDQVLKELGLRLKQTIRNTDPAARIGGEEFAVLLPNCSLDKAARIAERIRSTVSDAPIVLTNGDELSVTISLGAAHYPNNTEQPGSLPILADQMLYKAKETGRNRVCFSEKKE GT:EXON 1|1-359:0| SW:ID YHCK_BACSU SW:DE RecName: Full=Uncharacterized protein yhcK; SW:GN Name=yhcK; OrderedLocusNames=BSU09120; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->359|YHCK_BACSU|0.0|100.0|359/359| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 1->23| TM:REGION 38->60| TM:REGION 65->87| TM:REGION 96->118| TM:REGION 128->150| TM:REGION 157->177| SEG 107->114|iiiciaai| BL:PDB:NREP 1 BL:PDB:REP 195->352|1w25A|9e-29|44.6|157/454| RP:PDB:NREP 1 RP:PDB:REP 124->357|3breB|3e-36|29.8|228/328| RP:PFM:NREP 2 RP:PFM:REP 41->78|PF07694|2e-04|44.7|38/88|5TM-5TMR_LYT| RP:PFM:REP 192->350|PF00990|2e-34|46.5|157/160|GGDEF| HM:PFM:NREP 2 HM:PFM:REP 192->351|PF00990|1.1e-53|44.0|159/161|GGDEF| HM:PFM:REP 35->117|PF07694|6.3e-18|25.3|83/88|5TM-5TMR_LYT| GO:PFM:NREP 5 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF07694|IPR011620| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF07694|IPR011620| GO:PFM GO:0004673|"GO:protein histidine kinase activity"|PF07694|IPR011620| GO:PFM GO:0007047|"GO:cellular cell wall organization"|PF07694|IPR011620| GO:PFM GO:0016021|"GO:integral to membrane"|PF07694|IPR011620| RP:SCP:NREP 1 RP:SCP:REP 197->354|1w25A3|2e-38|41.4|157/162|d.58.29.2| HM:SCP:REP 197->358|1w25A3|2e-55|46.0|161/0|d.58.29.2|1/1|Nucleotide cyclase| OP:NHOMO 8810 OP:NHOMOORG 668 OP:PATTERN -------------------------------------------------------------------- GA36A---111---24211-1H22-111111-B5557H53ACASk-------635-----A83-B3J5553---------B168CK66--------------------1----------------11111111171BBB9911194oUVHKK123FF---3--9I9-EEJ4------------N8E549817B2888886782888888-23333888587E2HI333333AE11111111111111111111-122--1----3311-1-11111-----------------------------------------------5EC7K888888897B4J885455959--7BB69HGGD7759A622452--C396992-----26YSUA8JZPKVX4699489789J-WVOSSBPPBV62KRRQWWPWXcIEUE8F9292DDBC785--------CFF4-gAS11111111111111111111111-11111-77GB3BA842IFGGIHE8887EERa999938JSPFPHR-3ONKWIaLNX12qA8TSWUKYZbL-------56FOjo5JRHKJOQAnTLKN1KILbHPGYQ6776B665G766-111111---------TCIPE43bXHbeXrMnVjqhijgjnbjhhWgccXV*q---CaHh------DFJC3M7EEEDEDDDFC-CEDFE9ADEDDCDDEEDDGEHEDF--18489888888788897C799547A--E34444433444---U-1-1-FHGGGAqFm---------------9899939-1-GYSRQRXZYYeYWVVQVUZ-----2---YRTTSZYYYXbccttMOLNMNKDEG1111--b29966DD-1111111718-------------------------B94BA79777-1- ----1------------------------------------------------------------------------------------------1--------------------------------------------------------------2----5---------92----------1--9-----7---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 65.2 SQ:SECSTR ###########################################################################################################################HHHHHHHTccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTccccHHHHHHHHHHHHHHHHHHTcccEEEEEEEETTHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcEEEEccccEEEEEEETccHHHHHHHHHHHHHHHHTTccEccccTTEEccEEEEEEEEccccccHHHHHHHHHHHHHHHHTTTcccEEEccc## DISOP:02AL 356-359| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEcccEEEEEEccccHHHHHHHHHHHHHHHHHcccEEccccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEcccc //