[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcM
DDBJ      :yhcM         hypothetical protein
Swiss-Prot:YHCM_BACSU   RecName: Full=Uncharacterized protein yhcM;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   61->123 PF10500 * SR-25 0.00014 18.2 55/225  
:BLT:SWISS 1->151 YHCM_BACSU 4e-59 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12742.1 GT:GENE yhcM GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(988417..988872) GB:FROM 988417 GB:TO 988872 GB:DIRECTION - GB:GENE yhcM GB:PRODUCT hypothetical protein GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12742.1 GB:DB_XREF SubtiList:BG11591 UniProtKB/Swiss-Prot:P54597 GB:GENE:GENE yhcM LENGTH 151 SQ:AASEQ MLFNQRRGISPAALIIGSTMLITALSPQIRQRISGFITGQMNRRNSENNTFDASNVGNMVKQAFSGSSGSSGDNQDRSQHQSQRQNGRQHQHAGQQQPQHQHTQSQTRQTETAAKKRQPHYAEPIHFEQNAMNVMDDNTMMEMLEDLEPGR GT:EXON 1|1-151:0| SW:ID YHCM_BACSU SW:DE RecName: Full=Uncharacterized protein yhcM; SW:GN Name=yhcM; OrderedLocusNames=BSU09140; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->151|YHCM_BACSU|4e-59|100.0|151/100| SEG 65->72|sgssgssg| SEG 83->110|qrqngrqhqhagqqqpqhqhtqsqtrqt| HM:PFM:NREP 1 HM:PFM:REP 61->123|PF10500|0.00014|18.2|55/225|SR-25| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 39-54, 63-119, 149-151| PSIPRED ccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccccHHcHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcHHHHHHHHHHccccc //