[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcN
DDBJ      :yhcN         putative lipoprotein
Swiss-Prot:YHCN_BACSU   RecName: Full=Lipoprotein yhcN;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   82->184 PF09580 * Spore_YhcN_YlaJ 5e-10 35.6 %
:HMM:PFM   14->186 PF09580 * Spore_YhcN_YlaJ 2.5e-40 30.6 170/174  
:BLT:SWISS 1->189 YHCN_BACSU 6e-72 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12743.2 GT:GENE yhcN GT:PRODUCT putative lipoprotein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 989022..989591 GB:FROM 989022 GB:TO 989591 GB:DIRECTION + GB:GENE yhcN GB:PRODUCT putative lipoprotein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 9611260; Product type lp : lipoprotein GB:PROTEIN_ID CAB12743.2 GB:DB_XREF GOA:P54598 InterPro:IPR019076 SubtiList:BG11592 UniProtKB/Swiss-Prot:P54598 GB:GENE:GENE yhcN LENGTH 189 SQ:AASEQ MFGKKQVLASVLLIPLLMTGCGVADQGEGRRDNNDVRNVNYRNPANDDMRNVNNRDNVDNNVNDNVNNNRVNDDNNNDRKLEVADEAADKVTDLKEVKHADIIVAGNQAYVAVVLTNGNKGAVENNLKKKIAKKVRSTDKNIDNVYVSANPDFVERMQGYGKRIQNGDPIAGLFDEFTQTVQRVFPNAE GT:EXON 1|1-189:0| SW:ID YHCN_BACSU SW:DE RecName: Full=Lipoprotein yhcN;Flags: Precursor; SW:GN Name=yhcN; OrderedLocusNames=BSU09150; SW:KW Complete proteome; Direct protein sequencing; Lipoprotein; Membrane;Palmitate; Signal; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->189|YHCN_BACSU|6e-72|100.0|189/189| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| TM:NTM 1 TM:REGION 6->25| SEG 30->43|rrdnndvrnvnyrn| SEG 46->79|nddmrnvnnrdnvdnnvndnvnnnrvnddnnndr| RP:PFM:NREP 1 RP:PFM:REP 82->184|PF09580|5e-10|35.6|101/165|Spore_YhcN_YlaJ| HM:PFM:NREP 1 HM:PFM:REP 14->186|PF09580|2.5e-40|30.6|170/174|Spore_YhcN_YlaJ| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1------1-1111-------1---------1-------------------------------------------------------------------------------------------11---------------------1-------1---1------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 189-190| PSIPRED cccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHcccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHcccccccEEEEEccEEEEEEEEccccccccHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccc //