[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcO
DDBJ      :yhcO         hypothetical protein
Swiss-Prot:YHCO_BACSU   RecName: Full=Uncharacterized protein yhcO;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:322 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   150->191 3ihxB PDBj 9e-04 30.0 %
:HMM:PFM   94->174 PF10026 * DUF2268 0.00034 20.8 72/195  
:BLT:SWISS 1->322 YHCO_BACSU e-170 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12744.2 GT:GENE yhcO GT:PRODUCT hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 989712..990680 GB:FROM 989712 GB:TO 990680 GB:DIRECTION + GB:GENE yhcO GB:PRODUCT hypothetical protein GB:FUNCTION 18: Unknown function GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12744.2 GB:DB_XREF SubtiList:BG11593 UniProtKB/Swiss-Prot:P54599 GB:GENE:GENE yhcO LENGTH 322 SQ:AASEQ MRDGIGKRAASALFLCGVLVMLAVSSAIVSSAMYILSFPGQASGITKEQVTKHMKKESFKQADIYYTSKEKSLLPLTKETLEYAVSINQIMIGYSNQKPIDIIFFPNEKQMEAYSGLLDVVGFYSEREQLIGLLPEEKKKLLEGDEVAVYLYQRLLIHEYSHHAFHQKLKELETDPDEFPLWFHEGLSEWIANYELLIDPITFSVVPFDRLQTDRDWQEARAEYDTDVYLQSFYMIDELTDKYGKDIISEMIKETAKKGDFEKGFKSATKESLDQFEKDFKKKFEKNSAALDSIYPMPLLLVKSLLTHSALCRRHLSLGRGE GT:EXON 1|1-322:0| SW:ID YHCO_BACSU SW:DE RecName: Full=Uncharacterized protein yhcO;Flags: Precursor; SW:GN Name=yhcO; OrderedLocusNames=BSU09165; ORFNames=BSU09160/BSU09170; SW:KW Complete proteome; Signal. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->322|YHCO_BACSU|e-170|100.0|322/100| TM:NTM 1 TM:REGION 15->37| SEG 133->143|llpeekkklle| SEG 276->286|fekdfkkkfek| BL:PDB:NREP 1 BL:PDB:REP 150->191|3ihxB|9e-04|30.0|40/129| HM:PFM:NREP 1 HM:PFM:REP 94->174|PF10026|0.00034|20.8|72/195|DUF2268| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 40 STR:RPRED 12.4 SQ:SECSTR #####################################################################################################################################################TTTccEEEEEETTEEEEEEccccc##ccccEEEEcHHHHHHH################################################################################################################################### PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHcccEEEcccEEEEEcccHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccc //