[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcQ
DDBJ      :yhcQ         conserved hypothetical protein
Swiss-Prot:YHCQ_BACSU   RecName: Full=Spore coat protein F-like protein yhcQ;

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:217 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   121->180 PF07875 * Coat_F 2e-05 33.3 %
:HMM:PFM   121->184 PF07875 * Coat_F 9.5e-25 32.8 64/64  
:HMM:PFM   83->136 PF12520 * DUF3723 0.00033 22.7 44/504  
:BLT:SWISS 1->200 YHCQ_BACSU e-109 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12746.1 GT:GENE yhcQ GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(990612..991265) GB:FROM 990612 GB:TO 991265 GB:DIRECTION - GB:GENE yhcQ GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12746.1 GB:DB_XREF GOA:P54601 InterPro:IPR012851 SubtiList:BG11595 UniProtKB/Swiss-Prot:P54601 GB:GENE:GENE yhcQ LENGTH 217 SQ:AASEQ MDQFNQQQQSQMNKGIPGKPHKNHGGHEMFDMHEVLSGTLTVLDQFMMLRQFCKDQELLNILDRQHQFITSQYNITAECFKTGSEPSQKTATYMMKEDNQTVYGMQPSQPKKPVQSMNDIDDSIISRQMLCAIKAQASMLTMASLEMTNPAVRRVLSAQIQEYVEMAFEIFLYQNKHGYYQVPQLDAQDMEQLRNSFAPAQGQMPPTQGGMGQQGLH GT:EXON 1|1-217:0| SW:ID YHCQ_BACSU SW:DE RecName: Full=Spore coat protein F-like protein yhcQ; SW:GN Name=yhcQ; OrderedLocusNames=BSU09180; SW:KW Complete proteome; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->200|YHCQ_BACSU|e-109|100.0|200/217| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| SEG 3->11|qfnqqqqsq| SEG 201->215|qgqmpptqggmgqqg| RP:PFM:NREP 1 RP:PFM:REP 121->180|PF07875|2e-05|33.3|60/64|Coat_F| HM:PFM:NREP 2 HM:PFM:REP 121->184|PF07875|9.5e-25|32.8|64/64|Coat_F| HM:PFM:REP 83->136|PF12520|0.00033|22.7|44/504|DUF3723| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------111111------11--------1----------------------------------------------------------------------------------------------1---------------------------1---2-1----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-23, 108-118, 194-217| PSIPRED ccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccc //