[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcS
DDBJ      :yhcS         putative secreted enzyme; sortase
Swiss-Prot:YHCS_BACSU   RecName: Full=Uncharacterized protein yhcS;

Homologs  Archaea  0/68 : Bacteria  105/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.100.1
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->197 3g69B PDBj 1e-12 32.3 %
:RPS:SCOP  61->198 1t2oA  b.100.1.1 * 2e-31 18.2 %
:HMM:SCOP  58->198 1ijaA_ b.100.1.1 * 7.4e-32 40.1 %
:RPS:PFM   77->180 PF04203 * Sortase 9e-13 35.6 %
:HMM:PFM   75->197 PF04203 * Sortase 3e-29 35.2 122/128  
:HMM:PFM   28->82 PF08639 * SLD3 0.00081 19.2 52/496  
:BLT:SWISS 1->198 YHCS_BACSU e-112 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12748.1 GT:GENE yhcS GT:PRODUCT putative secreted enzyme; sortase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 994998..995594 GB:FROM 994998 GB:TO 995594 GB:DIRECTION + GB:GENE yhcS GB:PRODUCT putative secreted enzyme; sortase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 12823805; Product type pe : putative enzyme GB:PROTEIN_ID CAB12748.1 GB:DB_XREF GOA:P54603 InterPro:IPR005754 SubtiList:BG11597 UniProtKB/Swiss-Prot:P54603 GB:GENE:GENE yhcS LENGTH 198 SQ:AASEQ MKKVIPLFIIAAGLVIAGYGGFKLIDTNTKTEQTLKEAKLAAKKPQEASGTKNSTDQAKNKASFKPETGQASGILEIPKINAELPIVEGTDADDLEKGVGHYKDSYYPDENGQIVLSGHRDTVFRRTGELEKGDQLRLLLSYGEFTYEIVKTKIVDKDDTSIITLQHEKEELILTTCYPFSYVGNAPKRYIIYGKRVT GT:EXON 1|1-198:0| SW:ID YHCS_BACSU SW:DE RecName: Full=Uncharacterized protein yhcS; SW:GN Name=yhcS; OrderedLocusNames=BSU09200; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|YHCS_BACSU|e-112|100.0|198/198| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 4->26| BL:PDB:NREP 1 BL:PDB:REP 35->197|3g69B|1e-12|32.3|158/197| RP:PFM:NREP 1 RP:PFM:REP 77->180|PF04203|9e-13|35.6|104/126|Sortase| HM:PFM:NREP 2 HM:PFM:REP 75->197|PF04203|3e-29|35.2|122/128|Sortase| HM:PFM:REP 28->82|PF08639|0.00081|19.2|52/496|SLD3| RP:SCP:NREP 1 RP:SCP:REP 61->198|1t2oA|2e-31|18.2|132/143|b.100.1.1| HM:SCP:REP 58->198|1ijaA_|7.4e-32|40.1|137/148|b.100.1.1|1/1|Sortase| OP:NHOMO 182 OP:NHOMOORG 105 OP:PATTERN -------------------------------------------------------------------- --4-112------1---------------------------1-11-1-----1-----------------122221--11-2-------------------------------------------------------------------------------------------------------------111222224532362345332221233221-21---------1-------------------1--------------------1----2211211---1----1--1---------11----133---333----1-1111111-1-----1433-1-211-1---1-----1-----------------------111------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1--------1------1-1--1---------------------------------------------------------------------------------------------------1-----------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 81.3 SQ:SECSTR ##################################HHHHHHHHccccccccTTTTTcccccccccTTccTTccEEEEEGGGTEEEEEEEcccHHHHTTcEEEcTTcccTcTTEEEEEEcccccTTGGGGGccTTcEEEEEETTEEEEEEEEEEEEEcTTccGGGcccTTcEEEEEEEEEc##TTTcccEEEEEEEEEE# DISOP:02AL 34-66| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEcccEEEEEEcccHHHHHHccEEccccccccccccEEEEEEcccccccHHHcccccEEEEEEcccEEEEEEEEEEEEccccEEEEcccccccEEEEEEEccccccccccEEEEEEEEEcc //