[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcU
DDBJ      :yhcU         hypothetical protein; orphan
Swiss-Prot:YHCU_BACSU   RecName: Full=Uncharacterized protein yhcU;

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   94->119 PF01482 * DUF13 0.00029 34.6 26/89  
:HMM:PFM   56->100 PF02984 * Cyclin_C 0.00087 17.5 40/118  
:BLT:SWISS 1->131 YHCU_BACSU 1e-72 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12750.2 GT:GENE yhcU GT:PRODUCT hypothetical protein; orphan GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 996643..997038 GB:FROM 996643 GB:TO 997038 GB:DIRECTION + GB:GENE yhcU GB:PRODUCT hypothetical protein; orphan GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12750.2 GB:DB_XREF SubtiList:BG11599 UniProtKB/Swiss-Prot:P54605 GB:GENE:GENE yhcU LENGTH 131 SQ:AASEQ MARKVIDVRIVNAATAEQESFIKELSMELIHDVFPLYFSELDIQRFKKKGVLSLNNHYYQGTLKEAFQIMACLQMIHIILTKPSPHSDLSDQAIFEKNSKMLNDFGIYFPFAFSDFQKKTNKAFFGQRRLI GT:EXON 1|1-131:0| SW:ID YHCU_BACSU SW:DE RecName: Full=Uncharacterized protein yhcU; SW:GN Name=yhcU; OrderedLocusNames=BSU09220; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|YHCU_BACSU|1e-72|100.0|131/131| HM:PFM:NREP 2 HM:PFM:REP 94->119|PF01482|0.00029|34.6|26/89|DUF13| HM:PFM:REP 56->100|PF02984|0.00087|17.5|40/118|Cyclin_C| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------1111---111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 131-132| PSIPRED cccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccc //