[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhcV
DDBJ      :yhcV         putative oxidoreductase
Swiss-Prot:YHCV_BACSU   RecName: Full=Uncharacterized protein yhcV;

Homologs  Archaea  63/68 : Bacteria  583/915 : Eukaryota  80/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->118 1xkfB PDBj 2e-19 35.6 %
:RPS:PDB   3->117 2ef7A PDBj 7e-20 21.4 %
:RPS:SCOP  2->117 2yziA1  d.37.1.1 * 4e-30 29.3 %
:HMM:SCOP  6->66 1zfjA2 d.37.1.1 * 9.1e-14 37.7 %
:HMM:SCOP  64->118 2o16A2 d.37.1.1 * 2.4e-12 43.6 %
:RPS:PFM   10->117 PF00478 * IMPDH 1e-14 39.4 %
:HMM:PFM   4->54 PF00571 * CBS 3.3e-19 43.1 51/57  
:HMM:PFM   68->118 PF00571 * CBS 2.9e-15 33.3 51/57  
:BLT:SWISS 1->140 YHCV_BACSU 7e-75 100.0 %
:PROS 112->126|PS00211|ABC_TRANSPORTER_1
:REPEAT 2|2->55|66->119

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12751.1 GT:GENE yhcV GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 997175..997597 GB:FROM 997175 GB:TO 997597 GB:DIRECTION + GB:GENE yhcV GB:PRODUCT putative oxidoreductase GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB12751.1 GB:DB_XREF GOA:P54606 InterPro:IPR000644 SubtiList:BG11600 UniProtKB/Swiss-Prot:P54606 GB:GENE:GENE yhcV LENGTH 140 SQ:AASEQ MSSVKDTMTTQVATVSPNQTIQEAASLMKQHNVGAIPVVEQGVLKGMLTDRDIALRTTAQGRDGQTPVSEVMSTELVSGNPNMSLEDASQLMAQHQIRRLPIVDQNNLVGIVALGDLAVNQMSNESAGSALTNISHQNIH GT:EXON 1|1-140:0| SW:ID YHCV_BACSU SW:DE RecName: Full=Uncharacterized protein yhcV; SW:GN Name=yhcV; OrderedLocusNames=BSU09230; SW:KW Complete proteome; Repeat. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|YHCV_BACSU|7e-75|100.0|140/140| PROS 112->126|PS00211|ABC_TRANSPORTER_1|PDOC00185| NREPEAT 1 REPEAT 2|2->55|66->119| BL:PDB:NREP 1 BL:PDB:REP 1->118|1xkfB|2e-19|35.6|118/123| RP:PDB:NREP 1 RP:PDB:REP 3->117|2ef7A|7e-20|21.4|112/121| RP:PFM:NREP 1 RP:PFM:REP 10->117|PF00478|1e-14|39.4|99/459|IMPDH| HM:PFM:NREP 2 HM:PFM:REP 4->54|PF00571|3.3e-19|43.1|51/57|CBS| HM:PFM:REP 68->118|PF00571|2.9e-15|33.3|51/57|CBS| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 1 RP:SCP:REP 2->117|2yziA1|4e-30|29.3|116/132|d.37.1.1| HM:SCP:REP 6->66|1zfjA2|9.1e-14|37.7|61/64|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 64->118|2o16A2|2.4e-12|43.6|55/0|d.37.1.1|2/2|CBS-domain| OP:NHOMO 1480 OP:NHOMOORG 726 OP:PATTERN 5414136444444447--615245622324456-7763455557938884324633423421225--4 123-32-11111-211111-12--1211111133332111232412--111-21-1-111442123253311111111----221212111111------221123-252---------------32--1----1134456---1354422232111------1---2351------------22-4412-242111111111111111214423111244-112------32-11111111111111---111----------------------11111121112221111111111111--11111111121122111121222222222221211-222111122112-153224533434311111111112112111112334341212-2122122222122-23322322512131124354224333--231212112211111111122211341111-----11---------------1111-21211211115554543222266453433124652632111114312224346--22322111-------22345333333323233333-21212-1124564421511111-----11-1111111-1111-----12-1223221111-2122212212122---15-2---------------------------------------------------------------------------------------------11111-1-1--2-3------------11-1111111---2-3233111131111-111----------2221111112332221-1111-------1-2-331122---1--1-----------------------------2111233333-2- ----22---------21211111121222-222-1-2111-112111111--1-11111111111-1-----1-1------111--1--11-1222111111---2---------------------------------------------------------------------2----1--1-2214211-12221- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 87.9 SQ:SECSTR ccccGGGTcccccEEETTccHHHHHHHHHHHTccEEEEEETTEEEEEEEHHHHHHHHHTTccTccTccGGGTEEccccEETTccHHHHHHHHHHTccEEEEEcTTccEEEEEEHHHHHHHHHc################# DISOP:02AL 124-133, 138-140| PSIPRED cccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHcccccccHHHHHHccccc //