[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhdP
DDBJ      :yhdP         putative transporter or sensor
Swiss-Prot:YHDP_BACSU   RecName: Full=UPF0053 protein yhdP;

Homologs  Archaea  18/68 : Bacteria  864/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.37.1
:444 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   218->329 3hf7A PDBj 2e-07 24.1 %
:BLT:PDB   354->394 2rk5A PDBj 5e-04 36.6 %
:RPS:PDB   132->329 3bp1B PDBj 5e-31 11.3 %
:RPS:PDB   352->429 3dedB PDBj 3e-12 19.7 %
:RPS:SCOP  196->326 2ooxE1  d.37.1.1 * 1e-15 13.0 %
:RPS:SCOP  352->429 2p3hA1  d.145.1.4 * 1e-17 17.9 %
:HMM:SCOP  211->273 1nf7A3 d.37.1.1 * 1.8e-09 27.4 %
:HMM:SCOP  274->354 1pvmA2 d.37.1.1 * 1.8e-08 21.8 %
:RPS:PFM   22->177 PF01595 * DUF21 5e-26 43.8 %
:RPS:PFM   355->429 PF03471 * CorC_HlyC 5e-08 32.0 %
:HMM:PFM   5->201 PF01595 * DUF21 7.5e-56 35.2 182/183  
:HMM:PFM   355->430 PF03471 * CorC_HlyC 2.8e-19 30.3 76/81  
:HMM:PFM   216->272 PF00571 * CBS 6.4e-09 28.3 53/57  
:HMM:PFM   287->337 PF00571 * CBS 1.2e-08 19.6 51/57  
:BLT:SWISS 22->444 YHDP_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12794.1 GT:GENE yhdP GT:PRODUCT putative transporter or sensor GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1032063..1033397) GB:FROM 1032063 GB:TO 1033397 GB:DIRECTION - GB:GENE yhdP GB:PRODUCT putative transporter or sensor GB:FUNCTION 16.1: Circulate 16.12: Sense GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 10960106; Product type pt : putative transporter GB:PROTEIN_ID CAB12794.1 GB:DB_XREF GOA:O07585 InterPro:IPR002550 SubtiList:BG13022 UniProtKB/Swiss-Prot:O07585 GB:GENE:GENE yhdP LENGTH 444 SQ:AASEQ MDIVNLILVAVLIALTAFFVASEFAIIRIRGSRIDQLIAEGNKAAIAVKKVTTHLDEYLSACQLGITLTSIGLGVLGESTIERLLHPLFVQMNVPGSLSHVISFIFAYAIITFLHVVVGELAPKTVAIQKAEAVSMLFAKPLIWFYRIAFPFIWLLNNSARLLTKAFGLETVSENELAHSEEELRIILSESYKSGEINQSEFKYVNKIFEFDDRLAKEIMIPRTEIVSLPHDIKISEMMDIIQIEKYTRYPVEEGDKDNIIGVINIKEVLTACISGEVSVDSTISQFVNPIIHVIESAPIQDLLVKMQKERVHMAILSDEYGGTAGLVTVEDIIEEIVGEIRDEFDIDEISEIRKIGEGHYILDGKVLIDQVNDLLGIHLENEEVDTIGGWFLTQKYDVEKDDSIIEEGCEFIINEIDGHHVAYIEVKKLQEEELLETANQQEA GT:EXON 1|1-444:0| SW:ID YHDP_BACSU SW:DE RecName: Full=UPF0053 protein yhdP; SW:GN Name=yhdP; OrderedLocusNames=BSU09550; SW:KW CBS domain; Cell membrane; Complete proteome; Membrane; Repeat;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 22->444|YHDP_BACSU|0.0|100.0|423/444| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 7->28| TM:REGION 59->81| TM:REGION 98->120| TM:REGION 130->152| SEG 3->21|ivnlilvavlialtaffva| SEG 180->191|seeelriilses| SEG 330->344|vediieeivgeirde| SEG 430->437|lqeeelle| BL:PDB:NREP 2 BL:PDB:REP 218->329|3hf7A|2e-07|24.1|112/127| BL:PDB:REP 354->394|2rk5A|5e-04|36.6|41/86| RP:PDB:NREP 2 RP:PDB:REP 132->329|3bp1B|5e-31|11.3|195/250| RP:PDB:REP 352->429|3dedB|3e-12|19.7|76/83| RP:PFM:NREP 2 RP:PFM:REP 22->177|PF01595|5e-26|43.8|144/184|DUF21| RP:PFM:REP 355->429|PF03471|5e-08|32.0|75/81|CorC_HlyC| HM:PFM:NREP 4 HM:PFM:REP 5->201|PF01595|7.5e-56|35.2|182/183|DUF21| HM:PFM:REP 355->430|PF03471|2.8e-19|30.3|76/81|CorC_HlyC| HM:PFM:REP 216->272|PF00571|6.4e-09|28.3|53/57|CBS| HM:PFM:REP 287->337|PF00571|1.2e-08|19.6|51/57|CBS| RP:SCP:NREP 2 RP:SCP:REP 196->326|2ooxE1|1e-15|13.0|131/179|d.37.1.1| RP:SCP:REP 352->429|2p3hA1|1e-17|17.9|78/98|d.145.1.4| HM:SCP:REP 211->273|1nf7A3|1.8e-09|27.4|62/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 274->354|1pvmA2|1.8e-08|21.8|78/78|d.37.1.1|2/2|CBS-domain| OP:NHOMO 2264 OP:NHOMOORG 904 OP:PATTERN ------------------------533333411----------12122---11-------------12 2221423655533333333-36--3333333-66665355253553436443756233--444253459942222222112-2212223333-322---22313342411111111111111112221112221312222211122244233222111111113213233221122221222232311111-344444443444444442-6435445322234333333343222222222222222222231212222222211222221111121111111111111111111111111111111111111111111111-22231112222212123312222-122122-13311-11-------11231132231--11233333222333311111111112-223225223332322233333322222323243333222333333332333233322222222222222122222222222222-2222233322333333333333333333323333333411333323334322322252323331111111222333222222431223232222222222333333121111111111113111111111--122553333233424444423844433553314--3322211-11154223335555555554-4555555555455555554444333335555445444544455355555552-33333332333311332222233332323333333333332233322222223333333333333322233333333323323244434444434444223333333222222253111111222222223221111-------11---------1111111111111113 ------------------------------------------------------------------------------------------------1-1---------2-------------------------------------------------2----1-----------1--17111-17224-42111---3 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 66.0 SQ:SECSTR ###################################################################################################################################EEEEEEEEEEEEEEcTTccEEEEEEEEEEETTcHHHHHHHHTTTT###cccccHHHHHHHHHHHHHHHHTcccEEEEEEGGGGTTcccccccEEccccccccccccccGGGGTTcEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEcHHHHHHHHHcccHHHHHHHHHHHHHHTcccEEEEEEEEcccTTEEEEEEHHHHHHHHHHHHTTcccGGGc#cEEEcTTccEEEETTccHHHHHHHHTcccGGcccccHHHHHHHHcccccTTcEEEETTEEEEEEEET#TEEEEEEEEE############### DISOP:02AL 35-44, 174-196, 429-444| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEEEEEccccEEEEcccccHHHHHHHHHHccccEEEEEEcccccEEEEEEHHHHHHHHHccccccccHHHHHccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEHHHHHHHHHccccccccccccHHHEEccccEEEEEccccHHHHHHHHcccccccccccHHHHHHHHHcccccccEEEEccEEEEEEEEcccEEEEEEEEEccccccccccccccc //