[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yhdV
DDBJ      :yhdV         integral membrane protein possibly involved in chromosome condensation
Swiss-Prot:CRCB2_BACSU  RecName: Full=Protein crcB homolog 2;

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:131 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->113 PF02537 * CRCB 8e-06 40.2 %
:HMM:PFM   5->113 PF02537 * CRCB 1.4e-29 43.1 109/117  
:BLT:SWISS 1->131 CRCB2_BACSU 1e-59 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12800.1 GT:GENE yhdV GT:PRODUCT integral membrane protein possibly involved in chromosome condensation GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1037306..1037701) GB:FROM 1037306 GB:TO 1037701 GB:DIRECTION - GB:GENE yhdV GB:PRODUCT integral membrane protein possibly involved in chromosome condensation GB:FUNCTION 16.13: Shape 16.9: Replicate GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12904550, 15849754, 16850406, 8844142; Product type f: factor GB:PROTEIN_ID CAB12800.1 GB:DB_XREF GOA:O07591 InterPro:IPR003691 SubtiList:BG13028 UniProtKB/Swiss-Prot:O07591 GB:GENE:GENE yhdV LENGTH 131 SQ:AASEQ MKIYSAVFIGGALGACLRYGLNLWIHTGQFPAATWLENAAGSLLLGILTGFFMIGAKRPLLSAFLGTGFCGGFTTMSTFSKETVMLLQGQPSLALLYVAASLISGIIFALIGVFVGRRIAGIQQRKGLQEK GT:EXON 1|1-131:0| SW:ID CRCB2_BACSU SW:DE RecName: Full=Protein crcB homolog 2; SW:GN Name=crcB2; Synonyms=yhdV; OrderedLocusNames=BSU09610; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->131|CRCB2_BACSU|1e-59|100.0|131/131| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 1->23| TM:REGION 35->56| TM:REGION 59->80| TM:REGION 95->116| SEG 64->79|flgtgfcggfttmstf| RP:PFM:NREP 1 RP:PFM:REP 7->113|PF02537|8e-06|40.2|107/115|CRCB| HM:PFM:NREP 1 HM:PFM:REP 5->113|PF02537|1.4e-29|43.1|109/117|CRCB| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02537|IPR003691| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 128-131| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //