[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yheE
DDBJ      :yheE         conserved hypothetical protein
Swiss-Prot:YHEE_BACSU   RecName: Full=Uncharacterized protein yheE;

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:HMM:PFM   17->44 PF03633 * Glyco_hydro_65C 0.00048 25.0 28/54  
:BLT:SWISS 1->72 YHEE_BACSU 2e-42 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12815.1 GT:GENE yheE GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1050443..1050661) GB:FROM 1050443 GB:TO 1050661 GB:DIRECTION - GB:GENE yheE GB:PRODUCT conserved hypothetical protein GB:NOTE Evidence 4: Homologs of previously reported genes of unknown function GB:PROTEIN_ID CAB12815.1 GB:DB_XREF InterPro:IPR017263 SubtiList:BG13037 UniProtKB/Swiss-Prot:O07546 GB:GENE:GENE yheE LENGTH 72 SQ:AASEQ MAVMISHFSWKPLFPKEKLPGWKISFYYKGTHYEGIYHKSGEIEWGDLFPARADEPALTNEIHELMLFHIYD GT:EXON 1|1-72:0| SW:ID YHEE_BACSU SW:DE RecName: Full=Uncharacterized protein yheE; SW:GN Name=yheE; OrderedLocusNames=BSU09760; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->72|YHEE_BACSU|2e-42|100.0|72/100| HM:PFM:NREP 1 HM:PFM:REP 17->44|PF03633|0.00048|25.0|28/54|Glyco_hydro_65C| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------11111------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEccccccccccccEEEEEEccEEEEEEEccccEEEcccccccHHHHHHHHHHHHHHHHHEEcc //