[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : yheF
DDBJ      :yheF         hypothetical protein; orphan
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:41 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->41 YHEF_BACSU 9e-21 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12813.1 GT:GENE yheF GT:PRODUCT hypothetical protein; orphan GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1049801..1049926) GB:FROM 1049801 GB:TO 1049926 GB:DIRECTION - GB:GENE yheF GB:PRODUCT hypothetical protein; orphan GB:NOTE Evidence 5: No homology to any previously reported sequences GB:PROTEIN_ID CAB12813.1 GB:DB_XREF SubtiList:BG13038 UniProtKB/Swiss-Prot:O07547 GB:GENE:GENE yheF LENGTH 41 SQ:AASEQ MSFITIVNWELVQFVSVSMIHEYVSHRSVYLYRYSFPRCSN GT:EXON 1|1-41:0| BL:SWS:NREP 1 BL:SWS:REP 1->41|YHEF_BACSU|9e-21|100.0|41/100| TM:NTM 1 TM:REGION 2->24| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 40-41| PSIPRED ccEEEEEcHHHHHHHHHHHHHHHHcccEEEEEEEccccccc //